Protein Family IF05722
Metagenome
Isolate
136
Members
52
Samples
128
Scaffolds
254.97
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_144373|Ga0466700_144373_566_1405
- Length
- 279 aa
- Sequence
- MVMVQDCIGQGFFLERQKGKLMPYKHGRPVIDLSPWFRIASAWTFLLLIIPIAWLFNFMQHGTRYKHRWRMYGIRRAITVSNHTTFLDPVKISVLVLPRLIYQTLLEATVEFPFLGTFTRLLGGVPIPMGRAGYKKILEICDKAFKYRRYIHFYPEGECFLYSQHIGEFHTGAFKIAAELDIPIVPLVTVFSNGFLGNRGIFKPRSFWGRSLPVETLVVLEPVYPAHYIRRDSKGEITIRSIREFTEAVRQKMQQEIDRRNGSNAFFRGKMERIKGLND
Sample Types
Isolate
5.9%
Metagenome
94.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.0%
Kalotermitidae
28.0%
Unclassified
16.0%
Rhinotermitidae
6.0%
Termopsidae
6.0%
Taxonomy
Archaea
2
Bacteria
120
Eukaryota
0
Viruses
1
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 6 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 18 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 27 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_104197 | 3300042606 | Bacteria | 30611 |
| 2 | Ga0466720_026656 | 3300042607 | Bacteria | 7969 |
| 3 | Ga0466720_085121 | 3300042607 | Bacteria | 6634 |
| 4 | Ga0466692_149073 | 3300042591 | Bacteria | 4170 |
| 5 | Ga0466699_132504 | 3300042597 | Bacteria | 2287 |
| 6 | Ga0466699_161983 | 3300042597 | Bacteria | 13467 |
| 7 | Ga0466699_169854 | 3300042597 | Bacteria | 9635 |
| 8 | Ga0466701_010999 | 3300042598 | Unclassified | 2430 |
| 9 | JGI24695J34938_10000132 | 3300002450 | Bacteria | 67814 |
| 10 | JGI24695J34938_10024336 | 3300002450 | Bacteria | 2908 |
| 11 | Ga0072940_1003601 | 3300005200 | Bacteria | 22114 |
| 12 | Ga0072940_1017262 | 3300005200 | Bacteria | 7416 |
| 13 | Ga0072941_1002912 | 3300005201 | Bacteria | 12432 |
| 14 | Ga0072941_1022204 | 3300005201 | Bacteria | 10965 |
| 15 | Ga0072941_1065500 | 3300005201 | Archaea | 9865 |
| 16 | Ga0466700_144373 | 3300042600 | Bacteria | 1740 |
| 17 | Ga0466720_017925 | 3300042607 | Bacteria | 11697 |
| 18 | Ga0466722_111218 | 3300042609 | Bacteria | 4177 |
| 19 | Ga0466727_260941 | 3300042655 | Bacteria | 1969 |
| 20 | Ga0466711_236407 | 3300042615 | Bacteria | 3673 |
| 21 | Ga0264413_119961 | 3300024493 | Bacteria | 4176 |
| 22 | JGI24698J34947_10003956 | 3300002449 | Bacteria | 8060 |
| 23 | JGI24698J34947_10011741 | 3300002449 | Bacteria | 4810 |
| 24 | JGI24695J34938_10008089 | 3300002450 | Bacteria | 6054 |
| 25 | JGI24695J34938_10024566 | 3300002450 | Bacteria | 2892 |
| 26 | Ga0072941_1071650 | 3300005201 | Bacteria | 5372 |
| 27 | Ga0466732_331204 | 3300042656 | Unclassified | 1436 |
| 28 | Ga0466722_183338 | 3300042609 | Bacteria | 3278 |
| 29 | Ga0466698_413509 | 3300042610 | Bacteria | 3243 |
| 30 | Ga0466702_464647 | 3300042635 | Bacteria | 7935 |
| 31 | Ga0466709_239544 | 3300042648 | Bacteria | 1379 |
| 32 | Ga0466712_159386 | 3300042614 | Unclassified | 4186 |
| 33 | Ga0466711_052757 | 3300042615 | Bacteria | 13222 |
| 34 | Ga0466711_155412 | 3300042615 | Bacteria | 10135 |
| 35 | Ga0466715_577176 | 3300042616 | Bacteria | 7547 |
| 36 | Ga0466715_598907 | 3300042616 | Bacteria | 2318 |
| 37 | Ga0264413_103330 | 3300024493 | Bacteria | 6763 |
| 38 | Ga0466696_263273 | 3300042596 | Bacteria | 3255 |
| 39 | Ga0466699_111430 | 3300042597 | Bacteria | 3446 |
| 40 | AustNasuHG_c1000323 | 3300000089 | Bacteria | 16596 |
| 41 | JGI24698J34947_10091434 | 3300002449 | Unclassified | 1395 |
| 42 | JGI24695J34938_10000586 | 3300002450 | Bacteria | 35159 |
| 43 | Ga0466720_103827 | 3300042607 | Bacteria | 28288 |
| 44 | Ga0466720_167237 | 3300042607 | Bacteria | 43895 |
| 45 | Ga0123354_10118484 | 3300010882 | Bacteria | 3438 |
| 46 | Ga0466718_011237 | 3300042617 | Bacteria | 1317 |
| 47 | Ga0264413_100256 | 3300024493 | Bacteria | 6128 |
| 48 | Ga0264413_100697 | 3300024493 | Bacteria | 9944 |
| 49 | Ga0466690_121507 | 3300042590 | Unclassified | 2652 |
| 50 | Ga0466694_372592 | 3300042594 | Bacteria | 1320 |
| 51 | Ga0466699_245993 | 3300042597 | Bacteria | 2218 |
| 52 | Ga0466699_307954 | 3300042597 | Bacteria | 13307 |
| 53 | JGI24698J34947_10001435 | 3300002449 | Bacteria | 12537 |
| 54 | JGI24698J34947_10051534 | 3300002449 | Bacteria | 2069 |
| 55 | JGI24695J34938_10017395 | 3300002450 | Bacteria | 3622 |
| 56 | Ga0072941_1000677 | 3300005201 | Viruses | 3103 |
| 57 | Ga0072941_1022205 | 3300005201 | Bacteria | 1075 |
| 58 | Ga0466700_416386 | 3300042600 | Bacteria | 1030 |
| 59 | Ga0466717_214962 | 3300042604 | Bacteria | 1244 |
| 60 | Ga0466720_051363 | 3300042607 | Bacteria | 6093 |
| 61 | Ga0466720_162780 | 3300042607 | Bacteria | 14596 |
| 62 | Ga0466703_152035 | 3300042636 | Bacteria | 10357 |
| 63 | Ga0466704_101043 | 3300042643 | Bacteria | 55879 |
| 64 | Ga0466708_036794 | 3300042652 | Bacteria | 6881 |
| 65 | Ga0466708_211352 | 3300042652 | Bacteria | 3390 |
| 66 | Ga0466727_161097 | 3300042655 | Bacteria | 3579 |
| 67 | Ga0466712_043739 | 3300042614 | Bacteria | 8092 |
| 68 | Ga0466711_183350 | 3300042615 | Bacteria | 47393 |
| 69 | Ga0466723_009040 | 3300042618 | Bacteria | 2989 |
| 70 | Ga0415639_034039 | 3300038395 | Bacteria | 5768 |
| 71 | Ga0466692_003668 | 3300042591 | Bacteria | 7165 |
| 72 | Ga0466699_051898 | 3300042597 | Bacteria | 29918 |
| 73 | JGI24698J34947_10007308 | 3300002449 | Bacteria | 6070 |
| 74 | JGI24698J34947_10016868 | 3300002449 | Bacteria | 3962 |
| 75 | JGI24695J34938_10050091 | 3300002450 | Bacteria | 1833 |
| 76 | JGI24702J35022_10055407 | 3300002462 | Unclassified | 2115 |
| 77 | Ga0466732_077520 | 3300042656 | Unclassified | 1623 |
| 78 | Ga0466732_318295 | 3300042656 | Bacteria | 1915 |
| 79 | Ga0466717_241951 | 3300042604 | Bacteria | 1353 |
| 80 | Ga0466716_087643 | 3300042605 | Bacteria | 24320 |
| 81 | Ga0466720_038815 | 3300042607 | Bacteria | 10179 |
| 82 | Ga0466698_445428 | 3300042610 | Unclassified | 1968 |
| 83 | Ga0466698_486601 | 3300042610 | Bacteria | 1132 |
| 84 | Ga0123356_10069451 | 3300010049 | Bacteria | 3304 |
| 85 | Ga0466735_050880 | 3300042624 | Bacteria | 2596 |
| 86 | Ga0466708_090688 | 3300042652 | Bacteria | 3067 |
| 87 | Ga0466712_201063 | 3300042614 | Unclassified | 1940 |
| 88 | Ga0466711_013964 | 3300042615 | Bacteria | 2134 |
| 89 | Ga0466718_045807 | 3300042617 | Bacteria | 1850 |
| 90 | Ga0466726_325755 | 3300042619 | Bacteria | 3658 |
| 91 | Ga0466728_069868 | 3300042620 | Bacteria | 1842 |
| 92 | JGI24698J34947_10016010 | 3300002449 | Bacteria | 4077 |
| 93 | JGI24695J34938_10000640 | 3300002450 | Bacteria | 33416 |
| 94 | JGI24700J35501_10923034 | 3300002508 | Bacteria | 5074 |
| 95 | Ga0466705_031510 | 3300042612 | Bacteria | 1498 |
| 96 | Ga0466722_048546 | 3300042609 | Bacteria | 18150 |
| 97 | Ga0466722_049674 | 3300042609 | Bacteria | 7834 |
| 98 | Ga0123356_10006220 | 3300010049 | Bacteria | 12066 |
| 99 | Ga0123354_10299327 | 3300010882 | Unclassified | 1525 |
| 100 | Ga0466735_153004 | 3300042624 | Bacteria | 1809 |
| 101 | Ga0466708_031299 | 3300042652 | Bacteria | 8597 |
| 102 | Ga0466708_264725 | 3300042652 | Unclassified | 1217 |
| 103 | Ga0466712_111168 | 3300042614 | Bacteria | 1611 |
| 104 | Ga0466712_284884 | 3300042614 | Unclassified | 1012 |
| 105 | Ga0466718_062519 | 3300042617 | Bacteria | 1419 |
| 106 | Ga0466728_151650 | 3300042620 | Bacteria | 3657 |
| 107 | Ga0466696_448557 | 3300042596 | Archaea | 1429 |
| 108 | Ga0466699_137803 | 3300042597 | Bacteria | 13206 |
| 109 | JGI24698J34947_10010707 | 3300002449 | Bacteria | 5034 |
| 110 | Ga0072941_1033017 | 3300005201 | Bacteria | 2025 |
| 111 | Ga0466705_249636 | 3300042612 | Bacteria | 42301 |
| 112 | Ga0466732_002559 | 3300042656 | Bacteria | 3014 |
| 113 | Ga0466722_049613 | 3300042609 | Bacteria | 3495 |
| 114 | Ga0123353_10704961 | 3300010167 | Bacteria | 1416 |
| 115 | Ga0466703_222945 | 3300042636 | Bacteria | 19313 |
| 116 | Ga0466709_395365 | 3300042648 | Bacteria | 14172 |
| 117 | Ga0466709_414702 | 3300042648 | Bacteria | 3845 |
| 118 | Ga0466708_144254 | 3300042652 | Bacteria | 3306 |
| 119 | Ga0466727_340717 | 3300042655 | Bacteria | 2176 |
| 120 | Ga0456237_0002022 | 3300041968 | Unclassified | 3276 |
| 121 | Ga0466690_118658 | 3300042590 | Bacteria | 5585 |
| 122 | Ga0466691_025777 | 3300042593 | Bacteria | 3036 |
| 123 | Ga0466695_259092 | 3300042595 | Bacteria | 134193 |
| 124 | Ga0466699_280968 | 3300042597 | Bacteria | 14109 |
| 125 | JGI24698J34947_10026662 | 3300002449 | Bacteria | 3070 |
| 126 | JGI24695J34938_10003208 | 3300002450 | Bacteria | 11588 |
| 127 | JGI24695J34938_10004695 | 3300002450 | Bacteria | 8855 |
| 128 | JGI24702J35022_10024487 | 3300002462 | Bacteria | 3261 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042656 | Ga0466732_077520 | Ga0466732_077520_436_1098 | 220 |
| 2 | 3300042614 | Ga0466712_284884 | Ga0466712_284884_144_812 | 222 |
| 3 | 3300042598 | Ga0466701_010999 | Ga0466701_010999_514_1194 | 226 |
| 4 | 3300042635 | Ga0466702_464647 | Ga0466702_464647_3162_3842 | 226 |
| 5 | 3300042656 | Ga0466732_331204 | Ga0466732_331204_556_1236 | 226 |
| 6 | 3300010882 | Ga0123354_10299327 | Ga0123354_102993271 | 231 |
| 7 | 3300010882 | Ga0123354_10118484 | Ga0123354_101184843 | 232 |
| 8 | 3300042652 | Ga0466708_264725 | Ga0466708_264725_274_972 | 232 |
| 9 | 3300042652 | Ga0466708_090688 | Ga0466708_090688_57_758 | 233 |
| 10 | 3300042610 | Ga0466698_445428 | Ga0466698_445428_346_1050 | 234 |
| 11 | 3300042615 | Ga0466711_013964 | Ga0466711_013964_239_943 | 234 |
| 12 | 3300042597 | Ga0466699_245993 | Ga0466699_245993_660_1394 | 244 |
| 13 | 3300038395 | Ga0415639_034039 | Ga0415639_034039_451_1194 | 247 |
| 14 | 3300042652 | Ga0466708_144254 | Ga0466708_144254_122_865 | 247 |
| 15 | 3300042616 | Ga0466715_577176 | Ga0466715_577176_4279_5031 | 250 |
| 16 | 3300024493 | Ga0264413_100697 | Ga0264413_10069711 | 251 |
| 17 | 3300024493 | Ga0264413_119961 | Ga0264413_1199615 | 251 |
| 18 | 3300042594 | Ga0466694_372592 | Ga0466694_372592_201_956 | 251 |
| 19 | 3300042595 | Ga0466695_259092 | Ga0466695_259092_28661_29416 | 251 |
| 20 | 3300042597 | Ga0466699_111430 | Ga0466699_111430_2644_3399 | 251 |
| 21 | 3300042597 | Ga0466699_161983 | Ga0466699_161983_12361_13116 | 251 |
| 22 | 3300042597 | Ga0466699_280968 | Ga0466699_280968_12404_13159 | 251 |
| 23 | 3300042604 | Ga0466717_214962 | Ga0466717_214962_426_1181 | 251 |
| 24 | 3300042605 | Ga0466716_087643 | Ga0466716_087643_22406_23161 | 251 |
| 25 | 3300042606 | Ga0466719_104197 | Ga0466719_104197_5075_5830 | 251 |
| 26 | 3300042607 | Ga0466720_038815 | Ga0466720_038815_6888_7643 | 251 |
| 27 | 3300042607 | Ga0466720_103827 | Ga0466720_103827_19680_20435 | 251 |
| 28 | 3300042607 | Ga0466720_162780 | Ga0466720_162780_7430_8185 | 251 |
| 29 | 3300042612 | Ga0466705_031510 | Ga0466705_031510_524_1279 | 251 |
| 30 | 3300042612 | Ga0466705_249636 | Ga0466705_249636_38026_38781 | 251 |
| 31 | 3300042614 | Ga0466712_043739 | Ga0466712_043739_3091_3846 | 251 |
| 32 | 3300042615 | Ga0466711_052757 | Ga0466711_052757_12089_12844 | 251 |
| 33 | 3300042615 | Ga0466711_155412 | Ga0466711_155412_3324_4079 | 251 |
| 34 | 3300042615 | Ga0466711_183350 | Ga0466711_183350_30486_31241 | 251 |
| 35 | 3300042617 | Ga0466718_011237 | Ga0466718_011237_461_1216 | 251 |
| 36 | 3300042619 | Ga0466726_325755 | Ga0466726_325755_2402_3157 | 251 |
| 37 | 3300042624 | Ga0466735_050880 | Ga0466735_050880_1194_1949 | 251 |
| 38 | 3300042643 | Ga0466704_101043 | Ga0466704_101043_49357_50112 | 251 |
| 39 | 3300042655 | Ga0466727_260941 | Ga0466727_260941_968_1723 | 251 |
| 40 | 3300042655 | Ga0466727_340717 | Ga0466727_340717_236_991 | 251 |
| 41 | 3300042656 | Ga0466732_318295 | Ga0466732_318295_324_1079 | 251 |
| 42 | iso_pr_bacteria | 2781125683 | 2781410917 | 251 |
| 43 | iso_pr_bacteria | 2781125688 | 2781424279 | 251 |
| 44 | iso_pr_bacteria | 2781125696 | 2781441694 | 251 |
| 45 | 3300000089 | AustNasuHG_c1000323 | AustNasuHG_100032315 | 252 |
| 46 | 3300002449 | JGI24698J34947_10003956 | JGI24698J34947_100039565 | 252 |
| 47 | 3300002449 | JGI24698J34947_10007308 | JGI24698J34947_100073086 | 252 |
| 48 | 3300002449 | JGI24698J34947_10010707 | JGI24698J34947_100107072 | 252 |
| 49 | 3300002449 | JGI24698J34947_10011741 | JGI24698J34947_100117413 | 252 |
| 50 | 3300002449 | JGI24698J34947_10016868 | JGI24698J34947_100168682 | 252 |
| 51 | 3300002449 | JGI24698J34947_10091434 | JGI24698J34947_100914342 | 252 |
| 52 | 3300002450 | JGI24695J34938_10000132 | JGI24695J34938_1000013240 | 252 |
| 53 | 3300002450 | JGI24695J34938_10000586 | JGI24695J34938_100005867 | 252 |
| 54 | 3300002450 | JGI24695J34938_10000640 | JGI24695J34938_100006407 | 252 |
| 55 | 3300002450 | JGI24695J34938_10004695 | JGI24695J34938_100046952 | 252 |
| 56 | 3300002450 | JGI24695J34938_10050091 | JGI24695J34938_100500912 | 252 |
| 57 | 3300002462 | JGI24702J35022_10024487 | JGI24702J35022_100244872 | 252 |
| 58 | 3300002462 | JGI24702J35022_10055407 | JGI24702J35022_100554072 | 252 |
| 59 | 3300005200 | Ga0072940_1003601 | Ga0072940_100360114 | 252 |
| 60 | 3300005200 | Ga0072940_1017262 | Ga0072940_10172626 | 252 |
| 61 | 3300005201 | Ga0072941_1000677 | Ga0072941_10006772 | 252 |
| 62 | 3300005201 | Ga0072941_1033017 | Ga0072941_10330172 | 252 |
| 63 | 3300010049 | Ga0123356_10006220 | Ga0123356_100062208 | 252 |
| 64 | 3300010049 | Ga0123356_10069451 | Ga0123356_100694513 | 252 |
| 65 | 3300042590 | Ga0466690_118658 | Ga0466690_118658_3459_4217 | 252 |
| 66 | 3300042590 | Ga0466690_121507 | Ga0466690_121507_1113_1871 | 252 |
| 67 | 3300042593 | Ga0466691_025777 | Ga0466691_025777_1881_2639 | 252 |
| 68 | 3300042596 | Ga0466696_263273 | Ga0466696_263273_192_950 | 252 |
| 69 | 3300042596 | Ga0466696_448557 | Ga0466696_448557_454_1212 | 252 |
| 70 | 3300042616 | Ga0466715_598907 | Ga0466715_598907_1102_1860 | 252 |
| 71 | 3300042620 | Ga0466728_069868 | Ga0466728_069868_416_1174 | 252 |
| 72 | 3300042636 | Ga0466703_152035 | Ga0466703_152035_2601_3359 | 252 |
| 73 | 3300042636 | Ga0466703_222945 | Ga0466703_222945_13615_14373 | 252 |
| 74 | 3300042648 | Ga0466709_239544 | Ga0466709_239544_196_954 | 252 |
| 75 | 3300042648 | Ga0466709_395365 | Ga0466709_395365_11708_12466 | 252 |
| 76 | 3300042648 | Ga0466709_414702 | Ga0466709_414702_2509_3267 | 252 |
| 77 | 3300042652 | Ga0466708_031299 | Ga0466708_031299_4598_5356 | 252 |
| 78 | iso_pr_bacteria | 2781125640 | 2781287746 | 252 |
| 79 | iso_pr_bacteria | 2781125641 | 2781290109 | 252 |
| 80 | iso_pr_bacteria | 2819994798 | 2819995226 | 252 |
| 81 | 3300002449 | JGI24698J34947_10001435 | JGI24698J34947_100014354 | 253 |
| 82 | 3300002450 | JGI24695J34938_10003208 | JGI24695J34938_100032083 | 253 |
| 83 | 3300002450 | JGI24695J34938_10008089 | JGI24695J34938_100080892 | 253 |
| 84 | 3300002450 | JGI24695J34938_10017395 | JGI24695J34938_100173954 | 253 |
| 85 | 3300002450 | JGI24695J34938_10024336 | JGI24695J34938_100243362 | 253 |
| 86 | 3300002450 | JGI24695J34938_10024566 | JGI24695J34938_100245662 | 253 |
| 87 | 3300002508 | JGI24700J35501_10923034 | JGI24700J35501_109230342 | 253 |
| 88 | 3300005201 | Ga0072941_1002912 | Ga0072941_100291210 | 253 |
| 89 | 3300042597 | Ga0466699_137803 | Ga0466699_137803_12355_13116 | 253 |
| 90 | 3300042609 | Ga0466722_183338 | Ga0466722_183338_486_1247 | 253 |
| 91 | 3300042617 | Ga0466718_045807 | Ga0466718_045807_75_866 | 253 |
| 92 | 3300042609 | Ga0466722_049613 | Ga0466722_049613_2489_3253 | 254 |
| 93 | 3300042609 | Ga0466722_049674 | Ga0466722_049674_6828_7592 | 254 |
| 94 | 3300042656 | Ga0466732_002559 | Ga0466732_002559_653_1486 | 254 |
| 95 | 3300005201 | Ga0072941_1022204 | Ga0072941_10222046 | 256 |
| 96 | 3300005201 | Ga0072941_1022205 | Ga0072941_10222052 | 256 |
| 97 | 3300042652 | Ga0466708_036794 | Ga0466708_036794_3709_4479 | 256 |
| 98 | 3300042652 | Ga0466708_211352 | Ga0466708_211352_214_984 | 256 |
| 99 | 3300042655 | Ga0466727_161097 | Ga0466727_161097_2004_2774 | 256 |
| 100 | 3300024493 | Ga0264413_100256 | Ga0264413_1002562 | 257 |
| 101 | 3300042617 | Ga0466718_062519 | Ga0466718_062519_595_1368 | 257 |
| 102 | 3300005201 | Ga0072941_1071650 | Ga0072941_10716503 | 258 |
| 103 | 3300042614 | Ga0466712_201063 | Ga0466712_201063_1080_1856 | 258 |
| 104 | iso_pr_bacteria | 2781125682 | 2781409020 | 258 |
| 105 | 3300010167 | Ga0123353_10704961 | Ga0123353_107049612 | 259 |
| 106 | 3300042607 | Ga0466720_167237 | Ga0466720_167237_41176_41955 | 259 |
| 107 | 3300042610 | Ga0466698_486601 | Ga0466698_486601_26_805 | 259 |
| 108 | 3300002449 | JGI24698J34947_10051534 | JGI24698J34947_100515342 | 260 |
| 109 | 3300042614 | Ga0466712_159386 | Ga0466712_159386_2755_3537 | 260 |
| 110 | 3300002449 | JGI24698J34947_10026662 | JGI24698J34947_100266622 | 261 |
| 111 | 3300042597 | Ga0466699_132504 | Ga0466699_132504_86_871 | 261 |
| 112 | 3300041968 | Ga0456237_0002022 | Ga0456237_0002022_2384_3172 | 262 |
| 113 | iso_pr_bacteria | 2781125631 | 2781267740 | 262 |
| 114 | 3300042609 | Ga0466722_048546 | Ga0466722_048546_13688_14479 | 263 |
| 115 | 3300042591 | Ga0466692_003668 | Ga0466692_003668_4576_5373 | 265 |
| 116 | 3300024493 | Ga0264413_103330 | Ga0264413_1033304 | 270 |
| 117 | 3300042591 | Ga0466692_149073 | Ga0466692_149073_1415_2227 | 270 |
| 118 | 3300042597 | Ga0466699_169854 | Ga0466699_169854_725_1537 | 270 |
| 119 | 3300042607 | Ga0466720_017925 | Ga0466720_017925_5510_6322 | 270 |
| 120 | 3300042607 | Ga0466720_026656 | Ga0466720_026656_1792_2604 | 270 |
| 121 | 3300042607 | Ga0466720_051363 | Ga0466720_051363_2350_3162 | 270 |
| 122 | 3300042607 | Ga0466720_085121 | Ga0466720_085121_685_1497 | 270 |
| 123 | 3300002449 | JGI24698J34947_10016010 | JGI24698J34947_100160103 | 271 |
| 124 | 3300042609 | Ga0466722_111218 | Ga0466722_111218_955_1770 | 271 |
| 125 | 3300042597 | Ga0466699_307954 | Ga0466699_307954_508_1326 | 272 |
| 126 | 3300042610 | Ga0466698_413509 | Ga0466698_413509_234_1052 | 272 |
| 127 | 3300042624 | Ga0466735_153004 | Ga0466735_153004_260_1078 | 272 |
| 128 | 3300042615 | Ga0466711_236407 | Ga0466711_236407_878_1699 | 273 |
| 129 | 3300042618 | Ga0466723_009040 | Ga0466723_009040_120_941 | 273 |
| 130 | 3300042620 | Ga0466728_151650 | Ga0466728_151650_1088_1909 | 273 |
| 131 | 3300042600 | Ga0466700_416386 | Ga0466700_416386_177_1010 | 277 |
| 132 | 3300042600 | Ga0466700_144373 | Ga0466700_144373_566_1405 | 279 |
| 133 | 3300042614 | Ga0466712_111168 | Ga0466712_111168_286_1134 | 282 |
| 134 | 3300042597 | Ga0466699_051898 | Ga0466699_051898_468_1325 | 285 |
| 135 | 3300042604 | Ga0466717_241951 | Ga0466717_241951_344_1282 | 312 |
| 136 | 3300005201 | Ga0072941_1065500 | Ga0072941_10655003 | 335 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01553 | Acyltransferase | Acyltransferase | 75 | 188 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01553 | GO:0016746 | acyltransferase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.83 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.