Protein Family IF05710
Metagenome
Metatranscriptome
Isolate
487
Members
237
Samples
348
Scaffolds
177.99
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_041154|Ga0466700_041154_51088_51738
- Length
- 216 aa
- Sequence
- MIQVKKYRCHGTYPFRDLKFSPVKTPLGENLTGKGKYKMSRIGNKVVVIPAGVEVKQDGNVVTVKGPKGELTRTFVEQIKINIEGVEATVTRPDDTKESKALHGTTRALFHNMVVGVSEGFEKKLEMIGVGYRAQLQGTKLVLSVGKSHPDDVEAPEGIKFEVTDPTHITVSGASKEAVGQMAAYIRSRRSPEPYKGKGIRYVGEFVRRKEGKTGK
Sample Types
Isolate
28.5%
Metagenome
71.0%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
38.9%
Termitidae
18.1%
Formicidae
8.3%
Kalotermitidae
6.5%
Tenebrionidae
3.2%
Drosophilidae
3.2%
Elmidae
2.8%
Termopsidae
1.9%
Palinuridae
1.4%
Rhinotermitidae
1.4%
Talitridae
1.4%
Culicidae
1.4%
Blattidae
0.9%
Passalidae
0.9%
Scarabaeidae
0.9%
Apidae
0.9%
Calliphoridae
0.5%
Vespidae
0.5%
Bombycidae
0.5%
Hodotermitidae
0.5%
Pentatomidae
0.5%
Dytiscidae
0.5%
Gomphidae
0.5%
Artemiidae
0.5%
Majidae
0.5%
Alydidae
0.5%
Libellulidae
0.5%
Hydrophilidae
0.5%
Penaeidae
0.5%
Stratiomyidae
0.5%
Ixodidae
0.5%
Nephropidae
0.5%
Noctuidae
0.5%
Taxonomy
Archaea
0
Bacteria
466
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 2 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 3 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 4 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 5 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 6 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 7 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 8 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 9 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 10 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 11 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 12 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 13 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 14 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 15 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 19 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 20 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 21 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 22 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 23 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 28 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 29 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 30 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 31 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 42 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 43 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 44 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 45 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 46 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 47 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 48 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 49 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 50 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 51 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 52 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 53 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 54 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 55 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 58 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 59 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 60 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 61 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 62 | 2820836992 | Unclassified Actinobacteria Lab288P4bin32 | Isolate | Unclassified |
| 63 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 64 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 65 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 66 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 67 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 68 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 69 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 70 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 71 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 72 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 73 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 74 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 75 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 76 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 77 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 78 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 79 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 80 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 81 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 82 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 83 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 84 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 85 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 86 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 87 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 88 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 89 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 90 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 91 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 92 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 93 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 94 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 95 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 96 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 97 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 98 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 99 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 100 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 101 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 102 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 103 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 104 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 105 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 106 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 107 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 108 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 109 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 110 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 111 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 112 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 113 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 114 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 115 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 116 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 117 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 118 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 119 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 120 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 121 | 2820544053 | Unclassified Firmicutes Lab288P1bin108 | Isolate | Unclassified |
| 122 | 2820449349 | Unclassified Firmicutes Lab288P3bin191 | Isolate | Unclassified |
| 123 | 2820471304 | Unclassified Firmicutes Lab288P1bin89 | Isolate | Unclassified |
| 124 | 2820939604 | Unclassified Actinobacteria Emb289P1bin4 | Isolate | Unclassified |
| 125 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 126 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 127 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 128 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 129 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 130 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 131 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 132 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 133 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 134 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 135 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 136 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 137 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 138 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 139 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 140 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 141 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 142 | 3300023282 | Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA | Metatranscriptome | Termitidae |
| 143 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 144 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 145 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 146 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 147 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 148 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 149 | 2820176377 | Unclassified Planctomycetes Th196P3bin111 | Isolate | Unclassified |
| 150 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 151 | 2820411483 | Unclassified Firmicutes Lab288P4bin76 | Isolate | Unclassified |
| 152 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 153 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 154 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 155 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 156 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 157 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 158 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 159 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 160 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 161 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 162 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 163 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 164 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 165 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 166 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 167 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 168 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 169 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 170 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 171 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 172 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 173 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 174 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 175 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 176 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 177 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 178 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 179 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 180 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 181 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 182 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 183 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 184 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 185 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 186 | 2820098966 | Unclassified Proteobacteria Lab288P1bin49 | Isolate | Unclassified |
| 187 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 188 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 189 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 190 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 191 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 192 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 193 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 194 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 195 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 196 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 197 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 198 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 199 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 200 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 201 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 202 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 203 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 204 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 205 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 206 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 207 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 208 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 209 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 210 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 211 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 212 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 213 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 214 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 215 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 216 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 217 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 218 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 219 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 220 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 221 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 222 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 223 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 224 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 225 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 226 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 227 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 228 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 229 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 230 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 231 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Drosophilidae |
| 232 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 233 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 234 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 235 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 236 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 237 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_099832 | 3300042611 | Bacteria | 2564 |
| 2 | Ga0466705_210922 | 3300042612 | Bacteria | 8379 |
| 3 | Ga0466705_233768 | 3300042612 | Bacteria | 1933 |
| 4 | Ga0466705_347533 | 3300042612 | Bacteria | 1948 |
| 5 | Ga0466733_031656 | 3300042659 | Bacteria | 1148 |
| 6 | Ga0466733_074718 | 3300042659 | Bacteria | 2991 |
| 7 | Ga0562376_0063 | 3300056857 | Bacteria | 267702 |
| 8 | Ga0562376_2522 | 3300056857 | Bacteria | 21571 |
| 9 | Ga0160459_107283 | 3300012831 | Bacteria | 1395 |
| 10 | Ga0466692_008869 | 3300042591 | Bacteria | 1631 |
| 11 | Ga0466693_064087 | 3300042592 | Bacteria | 1052 |
| 12 | Ga0466693_347032 | 3300042592 | Bacteria | 1039 |
| 13 | Ga0466695_330258 | 3300042595 | Bacteria | 8795 |
| 14 | Ga0466715_372457 | 3300042616 | Bacteria | 41034 |
| 15 | Ga0466728_141395 | 3300042620 | Bacteria | 18755 |
| 16 | Ga0123357_10019205 | 3300009784 | Bacteria | 9102 |
| 17 | Ga0123357_10057959 | 3300009784 | Bacteria | 5203 |
| 18 | Ga0123355_10001369 | 3300009826 | Bacteria | 33944 |
| 19 | Ga0123355_10660433 | 3300009826 | Bacteria | 1216 |
| 20 | Ga0123356_10034643 | 3300010049 | Bacteria | 4718 |
| 21 | Ga0123353_10192231 | 3300010167 | Bacteria | 3220 |
| 22 | Ga0123353_11403668 | 3300010167 | Bacteria | 898 |
| 23 | Ga0123353_11642257 | 3300010167 | Bacteria | 809 |
| 24 | Ga0123353_11825883 | 3300010167 | Bacteria | 754 |
| 25 | Ga0466701_048756 | 3300042598 | Bacteria | 9025 |
| 26 | Ga0466706_236050 | 3300042599 | Bacteria | 32404 |
| 27 | Ga0466707_031260 | 3300042601 | Bacteria | 71521 |
| 28 | Ga0466717_222936 | 3300042604 | Bacteria | 2706 |
| 29 | Ga0466734_063340 | 3300042623 | Bacteria | 1700 |
| 30 | Ga0466734_097390 | 3300042623 | Bacteria | 1855 |
| 31 | Ga0466730_094777 | 3300042625 | Bacteria | 3709 |
| 32 | Ga0466708_383853 | 3300042652 | Bacteria | 11673 |
| 33 | Ga0466725_393761 | 3300042654 | Bacteria | 1001 |
| 34 | 2227467094 | 2225789004 | Bacteria | 959 |
| 35 | JGI24702J35022_10087080 | 3300002462 | Bacteria | 1696 |
| 36 | CVPL010W_10005074 | 3300002931 | Bacteria | 14271 |
| 37 | Ga0068305_10008598 | 3300005083 | Bacteria | 6108 |
| 38 | Ga0102734_1000264 | 3300007129 | Bacteria | 17175 |
| 39 | Ga0103260_1000849 | 3300007139 | Bacteria | 5716 |
| 40 | Ga0102738_1000014 | 3300007141 | Bacteria | 90212 |
| 41 | Ga0103267_1000050 | 3300007190 | Bacteria | 50670 |
| 42 | Ga0105005_1011255 | 3300007505 | Unclassified | 2877 |
| 43 | Ga0466697_256944 | 3300042611 | Bacteria | 3243 |
| 44 | Ga0466733_017210 | 3300042659 | Bacteria | 20046 |
| 45 | Ga0562376_0132 | 3300056857 | Bacteria | 164128 |
| 46 | Ga0562374_2092 | 3300057007 | Bacteria | 19473 |
| 47 | Ga0466656_229425 | 3300042550 | Bacteria | 1558 |
| 48 | Ga0466692_131937 | 3300042591 | Bacteria | 28333 |
| 49 | Ga0466692_196296 | 3300042591 | Bacteria | 21527 |
| 50 | Ga0466693_353530 | 3300042592 | Bacteria | 63745 |
| 51 | Ga0466691_171488 | 3300042593 | Bacteria | 19589 |
| 52 | Ga0466711_188397 | 3300042615 | Bacteria | 30134 |
| 53 | Ga0466715_183088 | 3300042616 | Bacteria | 24090 |
| 54 | Ga0466723_259805 | 3300042618 | Bacteria | 11102 |
| 55 | Ga0466728_361643 | 3300042620 | Bacteria | 10286 |
| 56 | Ga0123356_10018211 | 3300010049 | Bacteria | 6671 |
| 57 | Ga0123356_10074860 | 3300010049 | Bacteria | 3188 |
| 58 | Ga0123356_10269502 | 3300010049 | Bacteria | 1792 |
| 59 | Ga0123356_11490090 | 3300010049 | Bacteria | 834 |
| 60 | Ga0123353_10222117 | 3300010167 | Bacteria | 2953 |
| 61 | Ga0123353_10508592 | 3300010167 | Bacteria | 1752 |
| 62 | Ga0123354_10026674 | 3300010882 | Bacteria | 9113 |
| 63 | Ga0123354_10340686 | 3300010882 | Bacteria | 1352 |
| 64 | Ga0466701_083530 | 3300042598 | Bacteria | 21770 |
| 65 | Ga0466706_272844 | 3300042599 | Bacteria | 1326 |
| 66 | Ga0466700_227745 | 3300042600 | Bacteria | 1697 |
| 67 | Ga0466714_169031 | 3300042603 | Bacteria | 152952 |
| 68 | Ga0466719_347643 | 3300042606 | Bacteria | 8218 |
| 69 | Ga0466722_164005 | 3300042609 | Bacteria | 44727 |
| 70 | Ga0466702_002868 | 3300042635 | Bacteria | 60427 |
| 71 | Ga0466703_241993 | 3300042636 | Bacteria | 19818 |
| 72 | Ga0466703_276609 | 3300042636 | Bacteria | 60964 |
| 73 | Ga0466704_132141 | 3300042643 | Bacteria | 1580 |
| 74 | Ga0466704_384049 | 3300042643 | Bacteria | 13703 |
| 75 | Ga0466708_076108 | 3300042652 | Bacteria | 112124 |
| 76 | IMNBL1DRAFT_c0002829 | 3300000062 | Bacteria | 11691 |
| 77 | AustNasuHG_c1001775 | 3300000089 | Bacteria | 7810 |
| 78 | JGI24695J34938_10059858 | 3300002450 | Bacteria | 1627 |
| 79 | JGI24699J35502_10794559 | 3300002509 | Bacteria | 872 |
| 80 | JGI24699J35502_11134114 | 3300002509 | Bacteria | 32659 |
| 81 | JGI24696J40584_12758857 | 3300002834 | Bacteria | 805 |
| 82 | Ga0068302_10003269 | 3300005071 | Bacteria | 26234 |
| 83 | Ga0068305_10277852 | 3300005083 | Bacteria | 15502 |
| 84 | Ga0072941_1104413 | 3300005201 | Bacteria | 1662 |
| 85 | Ga0102737_1001337 | 3300007142 | Unclassified | 6978 |
| 86 | Ga0103264_1074437 | 3300007188 | Bacteria | 1543 |
| 87 | Ga0103268_1069209 | 3300007192 | Unclassified | 881 |
| 88 | Ga0466705_191850 | 3300042612 | Bacteria | 69130 |
| 89 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 90 | Ga0562379_0010 | 3300056790 | Bacteria | 1659178 |
| 91 | Ga0562377_0137 | 3300056842 | Bacteria | 212469 |
| 92 | Ga0562377_0345 | 3300056842 | Bacteria | 89531 |
| 93 | Ga0562374_0016 | 3300057007 | Bacteria | 1205025 |
| 94 | Ga0562374_0620 | 3300057007 | Bacteria | 54714 |
| 95 | Ga0160460_108605 | 3300012845 | Bacteria | 1303 |
| 96 | Ga0466657_141958 | 3300042582 | Bacteria | 2300 |
| 97 | Ga0466692_058899 | 3300042591 | Bacteria | 20827 |
| 98 | Ga0466693_113441 | 3300042592 | Bacteria | 28543 |
| 99 | Ga0466696_059591 | 3300042596 | Bacteria | 31859 |
| 100 | Ga0466696_448867 | 3300042596 | Bacteria | 2283 |
| 101 | Ga0466710_017395 | 3300042613 | Bacteria | 26782 |
| 102 | Ga0466711_389207 | 3300042615 | Bacteria | 1626 |
| 103 | Ga0466715_127844 | 3300042616 | Bacteria | 30892 |
| 104 | Ga0466715_157719 | 3300042616 | Bacteria | 36534 |
| 105 | Ga0466715_298115 | 3300042616 | Bacteria | 5916 |
| 106 | Ga0466723_027283 | 3300042618 | Bacteria | 8488 |
| 107 | Ga0466726_202544 | 3300042619 | Bacteria | 31324 |
| 108 | Ga0466728_240430 | 3300042620 | Bacteria | 19472 |
| 109 | Ga0123355_10577613 | 3300009826 | Bacteria | 1345 |
| 110 | Ga0123356_10070296 | 3300010049 | Bacteria | 3283 |
| 111 | Ga0123356_10677172 | 3300010049 | Bacteria | 1199 |
| 112 | Ga0123356_10985813 | 3300010049 | Bacteria | 1013 |
| 113 | Ga0123356_11615509 | 3300010049 | Unclassified | 802 |
| 114 | Ga0123353_10132825 | 3300010167 | Bacteria | 3993 |
| 115 | Ga0123353_10292624 | 3300010167 | Bacteria | 2492 |
| 116 | Ga0123353_10605578 | 3300010167 | Bacteria | 1564 |
| 117 | Ga0123353_10971280 | 3300010167 | Bacteria | 1146 |
| 118 | Ga0123353_11269905 | 3300010167 | Bacteria | 959 |
| 119 | Ga0123353_11473919 | 3300010167 | Unclassified | 869 |
| 120 | Ga0123353_11629367 | 3300010167 | Bacteria | 813 |
| 121 | Ga0123353_11988645 | 3300010167 | Unclassified | 713 |
| 122 | Ga0123354_10041538 | 3300010882 | Bacteria | 7107 |
| 123 | Ga0123354_10457536 | 3300010882 | Bacteria | 1028 |
| 124 | Ga0466700_041154 | 3300042600 | Bacteria | 59068 |
| 125 | Ga0466700_143196 | 3300042600 | Bacteria | 14202 |
| 126 | Ga0466700_225875 | 3300042600 | Bacteria | 17946 |
| 127 | Ga0466707_096499 | 3300042601 | Bacteria | 3477 |
| 128 | Ga0466713_091546 | 3300042602 | Bacteria | 18477 |
| 129 | Ga0466713_101308 | 3300042602 | Bacteria | 87772 |
| 130 | Ga0466713_127060 | 3300042602 | Bacteria | 78606 |
| 131 | Ga0466714_026145 | 3300042603 | Bacteria | 4058 |
| 132 | Ga0466714_162619 | 3300042603 | Bacteria | 2203 |
| 133 | Ga0466719_490310 | 3300042606 | Bacteria | 3402 |
| 134 | Ga0466721_399502 | 3300042608 | Bacteria | 7056 |
| 135 | Ga0466722_210785 | 3300042609 | Bacteria | 4412 |
| 136 | Ga0466708_165484 | 3300042652 | Bacteria | 1734 |
| 137 | Ga0466708_218447 | 3300042652 | Bacteria | 1977 |
| 138 | Ga0466725_415336 | 3300042654 | Bacteria | 6484 |
| 139 | Ga0466727_125041 | 3300042655 | Bacteria | 24880 |
| 140 | Ga0466727_131483 | 3300042655 | Bacteria | 12506 |
| 141 | 2227470324 | 2225789004 | Bacteria | 930 |
| 142 | IMNBL1DRAFT_c0000035 | 3300000062 | Bacteria | 120274 |
| 143 | JGI24702J35022_10000871 | 3300002462 | Bacteria | 18695 |
| 144 | JGI24703J35330_11701119 | 3300002501 | Bacteria | 2028 |
| 145 | JGI24705J35276_12227509 | 3300002504 | Bacteria | 3016 |
| 146 | CVPL010W_10010658 | 3300002931 | Bacteria | 8053 |
| 147 | Ga0072941_1012258 | 3300005201 | Bacteria | 37649 |
| 148 | Ga0104050_1028346 | 3300007153 | Bacteria | 893 |
| 149 | Ga0103267_1000266 | 3300007190 | Bacteria | 19495 |
| 150 | Ga0466697_071009 | 3300042611 | Bacteria | 1211 |
| 151 | Ga0466697_148543 | 3300042611 | Bacteria | 1025 |
| 152 | Ga0466705_248252 | 3300042612 | Bacteria | 15753 |
| 153 | Ga0160446_107716 | 3300012835 | Unclassified | 1438 |
| 154 | Ga0466710_148929 | 3300042613 | Bacteria | 1899 |
| 155 | Ga0466715_462559 | 3300042616 | Bacteria | 14908 |
| 156 | Ga0466715_602016 | 3300042616 | Bacteria | 1581 |
| 157 | Ga0466723_282837 | 3300042618 | Bacteria | 2130 |
| 158 | Ga0123356_10206626 | 3300010049 | Bacteria | 2008 |
| 159 | Ga0123356_10448570 | 3300010049 | Bacteria | 1438 |
| 160 | Ga0123356_10620964 | 3300010049 | Bacteria | 1246 |
| 161 | Ga0123356_10974030 | 3300010049 | Unclassified | 1019 |
| 162 | Ga0123356_11249694 | 3300010049 | Bacteria | 907 |
| 163 | Ga0123353_10320955 | 3300010167 | Bacteria | 2350 |
| 164 | Ga0123354_10002374 | 3300010882 | Bacteria | 24762 |
| 165 | Ga0123354_10030493 | 3300010882 | Bacteria | 8468 |
| 166 | Ga0123354_10141064 | 3300010882 | Bacteria | 2980 |
| 167 | Ga0123354_10519065 | 3300010882 | Bacteria | 917 |
| 168 | Ga0466706_221851 | 3300042599 | Bacteria | 3264 |
| 169 | Ga0466717_058368 | 3300042604 | Bacteria | 4391 |
| 170 | Ga0466721_380010 | 3300042608 | Bacteria | 2578 |
| 171 | Ga0466722_204183 | 3300042609 | Bacteria | 1145 |
| 172 | Ga0466704_368016 | 3300042643 | Bacteria | 2313 |
| 173 | Ga0466704_456921 | 3300042643 | Bacteria | 1101 |
| 174 | Ga0466708_116913 | 3300042652 | Bacteria | 23265 |
| 175 | JGI24702J35022_10017033 | 3300002462 | Bacteria | 3977 |
| 176 | JGI24696J40584_12729742 | 3300002834 | Unclassified | 769 |
| 177 | Ga0072941_1104412 | 3300005201 | Bacteria | 3660 |
| 178 | Ga0074278_108065 | 3300005721 | Bacteria | 3474 |
| 179 | Ga0102735_1000166 | 3300007080 | Bacteria | 17572 |
| 180 | Ga0102740_1001692 | 3300007140 | Unclassified | 5416 |
| 181 | Ga0102737_1000154 | 3300007142 | Bacteria | 22537 |
| 182 | Ga0103264_1000021 | 3300007188 | Bacteria | 137150 |
| 183 | Ga0103264_1092864 | 3300007188 | Unclassified | 737 |
| 184 | Ga0103267_1000332 | 3300007190 | Bacteria | 16518 |
| 185 | Ga0103268_1005123 | 3300007192 | Bacteria | 2657 |
| 186 | Ga0123357_10000330 | 3300009784 | Bacteria | 44905 |
| 187 | Ga0466705_260336 | 3300042612 | Bacteria | 6164 |
| 188 | Ga0466732_077377 | 3300042656 | Bacteria | 3461 |
| 189 | Ga0562375_0036 | 3300056856 | Bacteria | 609533 |
| 190 | Ga0466691_190377 | 3300042593 | Bacteria | 14046 |
| 191 | Ga0466695_042940 | 3300042595 | Bacteria | 2765 |
| 192 | Ga0466695_086795 | 3300042595 | Bacteria | 1790 |
| 193 | Ga0466715_321032 | 3300042616 | Bacteria | 166710 |
| 194 | Ga0466715_380256 | 3300042616 | Bacteria | 3248 |
| 195 | Ga0466715_424271 | 3300042616 | Bacteria | 3117 |
| 196 | Ga0466715_628666 | 3300042616 | Bacteria | 1566 |
| 197 | Ga0466715_633184 | 3300042616 | Bacteria | 1313 |
| 198 | Ga0466723_176571 | 3300042618 | Bacteria | 8762 |
| 199 | Ga0123355_10013798 | 3300009826 | Unclassified | 12590 |
| 200 | Ga0123356_10423612 | 3300010049 | Bacteria | 1474 |
| 201 | Ga0123353_10134975 | 3300010167 | Bacteria | 3958 |
| 202 | Ga0123353_10296682 | 3300010167 | Bacteria | 2471 |
| 203 | Ga0123353_10707815 | 3300010167 | Bacteria | 1412 |
| 204 | Ga0123354_10013687 | 3300010882 | Bacteria | 12601 |
| 205 | Ga0466701_080012 | 3300042598 | Bacteria | 1259 |
| 206 | Ga0466700_273694 | 3300042600 | Bacteria | 10313 |
| 207 | Ga0466700_386178 | 3300042600 | Bacteria | 3495 |
| 208 | Ga0466714_074012 | 3300042603 | Bacteria | 10127 |
| 209 | Ga0466716_157301 | 3300042605 | Bacteria | 6875 |
| 210 | Ga0466716_237498 | 3300042605 | Bacteria | 3703 |
| 211 | Ga0466716_391910 | 3300042605 | Bacteria | 1332 |
| 212 | Ga0466719_149212 | 3300042606 | Unclassified | 4970 |
| 213 | Ga0466719_280353 | 3300042606 | Bacteria | 1397 |
| 214 | Ga0466729_307483 | 3300042621 | Bacteria | 4040 |
| 215 | Ga0466731_066537 | 3300042622 | Bacteria | 2550 |
| 216 | Ga0466735_012514 | 3300042624 | Bacteria | 2837 |
| 217 | Ga0466703_409010 | 3300042636 | Bacteria | 16495 |
| 218 | Ga0466704_441700 | 3300042643 | Bacteria | 20268 |
| 219 | Ga0466709_346362 | 3300042648 | Bacteria | 31912 |
| 220 | JGI24705J35276_12223223 | 3300002504 | Bacteria | 2489 |
| 221 | JGI24700J35501_10918340 | 3300002508 | Bacteria | 4257 |
| 222 | Ga0052191_101148 | 3300003097 | Bacteria | 1781 |
| 223 | Ga0072941_1289878 | 3300005201 | Bacteria | 6081 |
| 224 | Ga0103264_1000784 | 3300007188 | Bacteria | 14690 |
| 225 | Ga0103268_1000263 | 3300007192 | Bacteria | 17329 |
| 226 | Ga0466697_139692 | 3300042611 | Bacteria | 246544 |
| 227 | Ga0466697_273416 | 3300042611 | Bacteria | 5101 |
| 228 | Ga0466705_206495 | 3300042612 | Bacteria | 9920 |
| 229 | Ga0466705_309138 | 3300042612 | Bacteria | 9773 |
| 230 | Ga0466705_312198 | 3300042612 | Bacteria | 1639 |
| 231 | Ga0466733_077820 | 3300042659 | Bacteria | 14205 |
| 232 | Ga0562376_2500 | 3300056857 | Bacteria | 21692 |
| 233 | Ga0415639_106722 | 3300038395 | Bacteria | 1052 |
| 234 | Ga0466656_126081 | 3300042550 | Bacteria | 1519 |
| 235 | Ga0466656_276970 | 3300042550 | Bacteria | 1297 |
| 236 | Ga0466657_051167 | 3300042582 | Bacteria | 10371 |
| 237 | Ga0466692_118916 | 3300042591 | Bacteria | 3981 |
| 238 | Ga0466696_252118 | 3300042596 | Bacteria | 6477 |
| 239 | Ga0466696_384617 | 3300042596 | Bacteria | 2756 |
| 240 | Ga0466710_038761 | 3300042613 | Bacteria | 64329 |
| 241 | Ga0466711_232888 | 3300042615 | Bacteria | 1778 |
| 242 | Ga0466711_308032 | 3300042615 | Bacteria | 1326 |
| 243 | Ga0466711_420482 | 3300042615 | Bacteria | 8461 |
| 244 | Ga0466715_367868 | 3300042616 | Bacteria | 44460 |
| 245 | Ga0466729_064076 | 3300042621 | Bacteria | 3236 |
| 246 | Ga0123356_10002105 | 3300010049 | Bacteria | 21469 |
| 247 | Ga0123356_10358786 | 3300010049 | Bacteria | 1584 |
| 248 | Ga0123353_10188304 | 3300010167 | Bacteria | 3260 |
| 249 | Ga0123353_10365032 | 3300010167 | Bacteria | 2168 |
| 250 | Ga0466701_079219 | 3300042598 | Bacteria | 4136 |
| 251 | Ga0466706_017090 | 3300042599 | Bacteria | 4762 |
| 252 | Ga0466706_023903 | 3300042599 | Bacteria | 8621 |
| 253 | Ga0466706_207347 | 3300042599 | Bacteria | 23214 |
| 254 | Ga0466706_217013 | 3300042599 | Bacteria | 1916 |
| 255 | Ga0466706_278468 | 3300042599 | Bacteria | 1760 |
| 256 | Ga0466707_048580 | 3300042601 | Bacteria | 11796 |
| 257 | Ga0466719_038739 | 3300042606 | Bacteria | 1828 |
| 258 | Ga0466704_070782 | 3300042643 | Bacteria | 11279 |
| 259 | Ga0466708_053951 | 3300042652 | Bacteria | 19818 |
| 260 | Ga0466727_266808 | 3300042655 | Bacteria | 1415 |
| 261 | JGI24705J35276_12235518 | 3300002504 | Bacteria | 6624 |
| 262 | JGI24697J35500_11177116 | 3300002507 | Bacteria | 1492 |
| 263 | Ga0068302_10062590 | 3300005071 | Unclassified | 11577 |
| 264 | Ga0068305_10297584 | 3300005083 | Bacteria | 1465 |
| 265 | Ga0072940_1184001 | 3300005200 | Bacteria | 931 |
| 266 | Ga0103263_102686 | 3300007042 | Bacteria | 2182 |
| 267 | Ga0102736_1000294 | 3300007052 | Bacteria | 10862 |
| 268 | Ga0102735_1007933 | 3300007080 | Unclassified | 1339 |
| 269 | Ga0466697_154583 | 3300042611 | Bacteria | 2561 |
| 270 | Ga0466733_006507 | 3300042659 | Bacteria | 7219 |
| 271 | Ga0466733_203615 | 3300042659 | Bacteria | 1042 |
| 272 | Ga0530661_000008 | 3300056564 | Bacteria | 327436 |
| 273 | Ga0562376_0179 | 3300056857 | Bacteria | 133712 |
| 274 | Ga0562376_3020 | 3300056857 | Bacteria | 18242 |
| 275 | Ga0562374_0653 | 3300057007 | Bacteria | 52705 |
| 276 | Ga0160441_100482 | 3300012825 | Bacteria | 29148 |
| 277 | Ga0466696_275372 | 3300042596 | Bacteria | 4421 |
| 278 | Ga0466699_121087 | 3300042597 | Bacteria | 3662 |
| 279 | Ga0466723_157225 | 3300042618 | Bacteria | 18330 |
| 280 | Ga0123356_10782325 | 3300010049 | Bacteria | 1125 |
| 281 | Ga0123353_10348896 | 3300010167 | Bacteria | 2231 |
| 282 | Ga0123353_11290689 | 3300010167 | Bacteria | 949 |
| 283 | Ga0123353_11314513 | 3300010167 | Bacteria | 937 |
| 284 | Ga0123354_10000498 | 3300010882 | Bacteria | 39457 |
| 285 | Ga0123354_10116493 | 3300010882 | Bacteria | 3484 |
| 286 | Ga0123354_10438608 | 3300010882 | Bacteria | 1069 |
| 287 | Ga0123354_10663751 | 3300010882 | Bacteria | 740 |
| 288 | Ga0466706_064416 | 3300042599 | Bacteria | 22081 |
| 289 | Ga0466706_131465 | 3300042599 | Bacteria | 1296 |
| 290 | Ga0466706_140589 | 3300042599 | Bacteria | 4364 |
| 291 | Ga0466706_256642 | 3300042599 | Bacteria | 1119 |
| 292 | Ga0466700_023040 | 3300042600 | Bacteria | 7156 |
| 293 | Ga0466707_025713 | 3300042601 | Bacteria | 84586 |
| 294 | Ga0466707_372990 | 3300042601 | Bacteria | 91697 |
| 295 | Ga0466707_419659 | 3300042601 | Bacteria | 1091 |
| 296 | Ga0466713_129806 | 3300042602 | Bacteria | 35433 |
| 297 | Ga0466716_072423 | 3300042605 | Bacteria | 2767 |
| 298 | Ga0466698_381561 | 3300042610 | Bacteria | 3036 |
| 299 | Ga0466731_007930 | 3300042622 | Bacteria | 5643 |
| 300 | Ga0466731_241301 | 3300042622 | Bacteria | 6272 |
| 301 | Ga0466734_155673 | 3300042623 | Bacteria | 3851 |
| 302 | Ga0466709_095139 | 3300042648 | Bacteria | 5665 |
| 303 | CVPL010L_1000541 | 3300002932 | Unclassified | 13391 |
| 304 | Ga0068305_10085917 | 3300005083 | Bacteria | 6918 |
| 305 | Ga0103266_1000393 | 3300007067 | Bacteria | 15021 |
| 306 | Ga0102737_1000494 | 3300007142 | Bacteria | 12852 |
| 307 | Ga0466733_091923 | 3300042659 | Bacteria | 5139 |
| 308 | Ga0466733_134275 | 3300042659 | Bacteria | 2401 |
| 309 | Ga0562377_0008 | 3300056842 | Bacteria | 1610398 |
| 310 | Ga0562376_0197 | 3300056857 | Unclassified | 123752 |
| 311 | Ga0255808_1021726 | 3300023282 | Bacteria | 686 |
| 312 | Ga0255808_1021727 | 3300023282 | Bacteria | 664 |
| 313 | Ga0265387_1050279 | 3300024582 | Bacteria | 746 |
| 314 | Ga0466690_147457 | 3300042590 | Bacteria | 20788 |
| 315 | Ga0466690_339341 | 3300042590 | Bacteria | 1091 |
| 316 | Ga0466693_148381 | 3300042592 | Bacteria | 1639 |
| 317 | Ga0466691_154761 | 3300042593 | Unclassified | 19997 |
| 318 | Ga0466710_305189 | 3300042613 | Bacteria | 1752 |
| 319 | Ga0466711_081231 | 3300042615 | Bacteria | 2183 |
| 320 | Ga0466711_163992 | 3300042615 | Bacteria | 16015 |
| 321 | Ga0466711_322571 | 3300042615 | Bacteria | 3767 |
| 322 | Ga0466729_112686 | 3300042621 | Bacteria | 10506 |
| 323 | Ga0466729_179085 | 3300042621 | Bacteria | 60360 |
| 324 | Ga0123355_10042098 | 3300009826 | Bacteria | 7435 |
| 325 | Ga0123356_10002206 | 3300010049 | Bacteria | 20947 |
| 326 | Ga0123356_10136488 | 3300010049 | Bacteria | 2412 |
| 327 | Ga0123356_10301653 | 3300010049 | Bacteria | 1707 |
| 328 | Ga0123356_11785687 | 3300010049 | Bacteria | 764 |
| 329 | Ga0123353_10107212 | 3300010167 | Bacteria | 4502 |
| 330 | Ga0123353_10456368 | 3300010167 | Bacteria | 1879 |
| 331 | Ga0123353_11882974 | 3300010167 | Bacteria | 739 |
| 332 | Ga0123354_10258326 | 3300010882 | Bacteria | 1746 |
| 333 | Ga0466706_175288 | 3300042599 | Bacteria | 3442 |
| 334 | Ga0466713_143789 | 3300042602 | Bacteria | 39342 |
| 335 | Ga0466717_224333 | 3300042604 | Bacteria | 4500 |
| 336 | Ga0466717_271615 | 3300042604 | Bacteria | 2851 |
| 337 | Ga0466734_029421 | 3300042623 | Bacteria | 26553 |
| 338 | Ga0466724_63067 | 3300042649 | Bacteria | 2519 |
| 339 | JGI24705J35276_12223229 | 3300002504 | Bacteria | 2489 |
| 340 | JGI24699J35502_11134150 | 3300002509 | Bacteria | 37878 |
| 341 | Ga0068305_10059637 | 3300005083 | Bacteria | 5268 |
| 342 | Ga0074309_1035665 | 3300005314 | Bacteria | 2967 |
| 343 | Ga0103265_1003960 | 3300007068 | Unclassified | 2139 |
| 344 | Ga0103261_1000483 | 3300007083 | Unclassified | 6093 |
| 345 | Ga0102734_1006675 | 3300007129 | Bacteria | 2934 |
| 346 | Ga0102740_1004016 | 3300007140 | Unclassified | 3004 |
| 347 | Ga0103264_1000195 | 3300007188 | Bacteria | 65205 |
| 348 | Ga0105005_1125570 | 3300007505 | Bacteria | 2015 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00347 | Ribosomal_L6 | Ribosomal protein L6 | 128 | 202 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.