Protein Family IF05708

Metagenome Metatranscriptome Isolate
159 Members
72 Samples
132 Scaffolds
129.64 Avg Length

🧬 Representative Sequence

ID
3300042600|Ga0466700_029793|Ga0466700_029793_546_998
Length
150 aa
Sequence
MAFLFFVYFVLFAVKNYERQVVIMKVTVRLRMSTQDAHYAGNLVDGARMLALFGDVATELLIRNDGDEGLFRAYNMVEFLAPVYAGDYIEASGEIIEQGNTSRKMRFEARKVIIPRPDVGETACDVLDEPIIVCKAEGTCVVPKDKQRGK

📊 Sample Types

Isolate 17.0%
Metagenome 82.4%
MAG 0.0%
Metatranscriptome 0.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.8%
Unclassified 36.6%
Kalotermitidae 12.7%
Passalidae 2.8%
Blattidae 2.8%
Termopsidae 1.4%
Rhinotermitidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 141
Eukaryota 0
Viruses 1
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
2 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
3 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
4 2820727601 Unclassified Cloacimonetes Nt197P3bin46 Isolate Unclassified
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
7 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
8 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
9 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
10 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
11 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
12 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
15 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
16 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
17 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
21 2590828840 Clostridium sp. 2 Isolate Termitidae
22 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
23 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
24 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
25 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
26 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
29 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
33 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
34 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
35 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
36 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
44 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
45 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
46 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
47 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
48 3004677695 Bacteroides sp. 214 Isolate Blattidae
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
50 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
51 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
52 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
53 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
54 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
55 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
56 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
57 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
58 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
59 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
60 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
61 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
62 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
63 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
64 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
65 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
66 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
67 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
68 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
69 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
70 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
71 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
72 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466731_070587 3300042622 Unclassified 1810
2 Ga0466725_325951 3300042654 Bacteria 1842
3 Ga0415639_040262 3300038395 Bacteria 8658
4 Ga0415639_162177 3300038395 Bacteria 2004
5 Ga0466656_360952 3300042550 Unclassified 1006
6 Ga0466693_104581 3300042592 Bacteria 1815
7 Ga0466695_327353 3300042595 Bacteria 2161
8 Ga0123355_10000338 3300009826 Bacteria 60591
9 Ga0123355_10241259 3300009826 Unclassified 2560
10 Ga0123353_10084622 3300010167 Bacteria 5106
11 Ga0123353_10234508 3300010167 Bacteria 2858
12 Ga0123353_11278236 3300010167 Bacteria 955
13 Ga0466701_021930 3300042598 Bacteria 3655
14 Ga0466706_113834 3300042599 Bacteria 29446
15 Ga0466706_287186 3300042599 Bacteria 8197
16 Ga0466707_068918 3300042601 Bacteria 4331
17 Ga0466719_318959 3300042606 Bacteria 1419
18 Ga0466711_098772 3300042615 Bacteria 5683
19 IMNBL1DRAFT_c0002916 3300000062 Bacteria 11435
20 JGI24695J34938_10079429 3300002450 Bacteria 1357
21 Ga0072940_1522580 3300005200 Bacteria 1076
22 Ga0466709_390589 3300042648 Bacteria 49108
23 Ga0123357_10032883 3300009784 Bacteria 7045
24 Ga0123355_10115208 3300009826 Bacteria 4186
25 Ga0123355_11004140 3300009826 Unclassified 885
26 Ga0123356_10237336 3300010049 Bacteria 1892
27 Ga0466706_116238 3300042599 Bacteria 1635
28 Ga0466707_265399 3300042601 Bacteria 43241
29 Ga0466714_125023 3300042603 Bacteria 1432
30 Ga0466715_235473 3300042616 Bacteria 20328
31 Ga0466718_086913 3300042617 Bacteria 1239
32 IMNBL1DRAFT_c0009898 3300000062 Bacteria 4638
33 IMNBL1DRAFT_c0010471 3300000062 Bacteria 4433
34 JGI24695J34938_10088229 3300002450 Unclassified 1275
35 JGI24702J35022_10020219 3300002462 Bacteria 3615
36 Ga0466735_180228 3300042624 Bacteria 4971
37 Ga0466703_339680 3300042636 Archaea 2596
38 Ga0466709_160542 3300042648 Bacteria 33247
39 Ga0466724_18903 3300042649 Bacteria 1603
40 Ga0415639_003875 3300038395 Bacteria 31877
41 Ga0466694_001163 3300042594 Bacteria 7133
42 Ga0466695_159436 3300042595 Bacteria 18608
43 Ga0123356_10386122 3300010049 Bacteria 1534
44 Ga0123356_12525588 3300010049 Unclassified 643
45 Ga0123353_10040048 3300010167 Bacteria 7387
46 Ga0123353_12637912 3300010167 Bacteria 593
47 Ga0466706_184233 3300042599 Bacteria 5034
48 Ga0466700_029793 3300042600 Bacteria 1026
49 Ga0466700_077487 3300042600 Bacteria 1000
50 Ga0466707_040295 3300042601 Bacteria 66644
51 Ga0466721_045557 3300042608 Bacteria 1572
52 JGI24702J35022_10048832 3300002462 Bacteria 2253
53 Ga0466733_197328 3300042659 Bacteria 2613
54 Ga0123356_12257986 3300010049 Bacteria 680
55 Ga0123356_12758301 3300010049 Unclassified 615
56 Ga0123353_10196556 3300010167 Bacteria 3178
57 Ga0123353_12159411 3300010167 Unclassified 675
58 Ga0123353_12654656 3300010167 Bacteria 591
59 Ga0123353_13020998 3300010167 Unclassified 544
60 Ga0466706_164885 3300042599 Bacteria 2895
61 Ga0466706_276437 3300042599 Bacteria 2379
62 Ga0466713_036401 3300042602 Bacteria 32383
63 Ga0466716_007228 3300042605 Bacteria 17371
64 2227097471 2225789004 Bacteria 9703
65 IMNBL1DRAFT_c0033758 3300000062 Bacteria 1829
66 IMNBL1DRAFT_c0146348 3300000062 Unclassified 608
67 Ga0123357_10000228 3300009784 Bacteria 53070
68 Ga0466732_326694 3300042656 Unclassified 10491
69 Ga0466732_377951 3300042656 Bacteria 2052
70 Ga0466703_263516 3300042636 Bacteria 2186
71 Ga0466695_148009 3300042595 Bacteria 1051
72 Ga0466699_233800 3300042597 Bacteria 3032
73 Ga0123355_10770294 3300009826 Bacteria 1082
74 Ga0123356_11866594 3300010049 Bacteria 748
75 Ga0123356_12960233 3300010049 Bacteria 593
76 Ga0123353_13134436 3300010167 Bacteria 532
77 JGI24702J35022_10014829 3300002462 Bacteria 4294
78 JGI24702J35022_10127868 3300002462 Bacteria 1408
79 Ga0466725_056525 3300042654 Bacteria 7760
80 Ga0466656_014448 3300042550 Bacteria 2955
81 Ga0466690_066575 3300042590 Bacteria 7585
82 Ga0466694_101706 3300042594 Unclassified 1018
83 Ga0123355_10000458 3300009826 Bacteria 53649
84 Ga0123356_11474219 3300010049 Bacteria 839
85 Ga0123353_10016386 3300010167 Bacteria 10833
86 Ga0123353_10292214 3300010167 Bacteria 2494
87 Ga0123353_10926801 3300010167 Bacteria 1182
88 Ga0123353_11179017 3300010167 Bacteria 1008
89 Ga0123354_10065743 3300010882 Bacteria 5305
90 Ga0466722_180937 3300042609 Bacteria 8086
91 Ga0466710_337220 3300042613 Bacteria 1552
92 Ga0466715_629769 3300042616 Bacteria 55391
93 JGI24702J35022_10025136 3300002462 Bacteria 3215
94 JGI24702J35022_10040328 3300002462 Viruses 2490
95 Ga0072941_1097719 3300005201 Bacteria 3511
96 Ga0466735_156272 3300042624 Unclassified 1907
97 Ga0466708_233217 3300042652 Bacteria 21512
98 Ga0223688_1013139 3300021227 Bacteria 709
99 Ga0466695_381454 3300042595 Bacteria 2016
100 Ga0123355_10000231 3300009826 Bacteria 71111
101 Ga0123356_12093606 3300010049 Bacteria 706
102 Ga0466700_077086 3300042600 Bacteria 2517
103 Ga0466713_135203 3300042602 Bacteria 1243
104 Ga0466713_150340 3300042602 Bacteria 42021
105 Ga0466717_189350 3300042604 Bacteria 1346
106 Ga0466719_217941 3300042606 Bacteria 2756
107 Ga0466721_143418 3300042608 Unclassified 2409
108 Ga0466710_065032 3300042613 Bacteria 2853
109 Ga0466715_268961 3300042616 Bacteria 20226
110 Ga0466723_101296 3300042618 Bacteria 56220
111 2227563493 2225789004 Bacteria 54164
112 Ga0466733_086518 3300042659 Bacteria 10515
113 Ga0466709_304600 3300042648 Bacteria 78097
114 Ga0466724_59132 3300042649 Bacteria 1147
115 Ga0466694_192808 3300042594 Bacteria 1799
116 Ga0466699_395697 3300042597 Bacteria 3837
117 Ga0123355_10001355 3300009826 Bacteria 34038
118 Ga0123355_10196319 3300009826 Bacteria 2959
119 Ga0123355_10998181 3300009826 Bacteria 889
120 Ga0123356_10041965 3300010049 Bacteria 4263
121 Ga0123356_13152236 3300010049 Unclassified 574
122 Ga0123353_10348748 3300010167 Bacteria 2232
123 Ga0123353_11304252 3300010167 Bacteria 942
124 Ga0466721_091208 3300042608 Unclassified 1180
125 Ga0466722_010259 3300042609 Bacteria 5774
126 Ga0466722_121292 3300042609 Bacteria 2342
127 Ga0466715_060803 3300042616 Bacteria 5672
128 IMNBL1DRAFT_c0017810 3300000062 Bacteria 2973
129 JGI24695J34938_10012543 3300002450 Bacteria 4486
130 JGI24702J35022_10007838 3300002462 Bacteria 6088
131 JGI24702J35022_10944268 3300002462 Bacteria 537
132 JGI24700J35501_10929075 3300002508 Bacteria 8522

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042592 Ga0466693_104581 Ga0466693_104581_573_935 120
2 3300010167 Ga0123353_13020998 Ga0123353_130209982 121
3 iso_pr_bacteria 2820481688 2820482534 123
4 3300042616 Ga0466715_235473 Ga0466715_235473_15224_15598 124
5 3300002450 JGI24695J34938_10079429 JGI24695J34938_100794291 125
6 3300005200 Ga0072940_1522580 Ga0072940_15225802 125
7 3300010049 Ga0123356_13152236 Ga0123356_131522361 126
8 3300042590 Ga0466690_066575 Ga0466690_066575_3487_3867 126
9 3300042601 Ga0466707_068918 Ga0466707_068918_212_592 126
10 3300042618 Ga0466723_101296 Ga0466723_101296_21100_21480 126
11 3300042649 Ga0466724_18903 Ga0466724_18903_37_417 126
12 iso_pr_bacteria 2820596822 2820597096 126
13 iso_pr_bacteria 2820620956 2820622525 126
14 iso_pr_bacteria 2820637417 2820638356 126
15 iso_pr_bacteria 2820683647 2820685054 126
16 iso_pr_bacteria 2820707375 2820708996 126
17 iso_pr_bacteria 2820792843 2820794963 126
18 iso_pr_bacteria 2820795054 2820795760 126
19 2225789004 2227563493 2228102106 127
20 3300002450 JGI24695J34938_10088229 JGI24695J34938_100882292 127
21 3300002462 JGI24702J35022_10944268 JGI24702J35022_109442681 127
22 3300009784 Ga0123357_10032883 Ga0123357_100328833 127
23 3300009826 Ga0123355_10000231 Ga0123355_1000023128 127
24 3300009826 Ga0123355_10000338 Ga0123355_1000033829 127
25 3300009826 Ga0123355_10001355 Ga0123355_100013558 127
26 3300009826 Ga0123355_10770294 Ga0123355_107702942 127
27 3300010049 Ga0123356_10386122 Ga0123356_103861222 127
28 3300010167 Ga0123353_10234508 Ga0123353_102345082 127
29 3300010167 Ga0123353_10292214 Ga0123353_102922141 127
30 3300010167 Ga0123353_12637912 Ga0123353_126379121 127
31 3300038395 Ga0415639_040262 Ga0415639_040262_4375_4758 127
32 3300038395 Ga0415639_162177 Ga0415639_162177_1532_1915 127
33 3300042594 Ga0466694_001163 Ga0466694_001163_3440_3823 127
34 3300042594 Ga0466694_101706 Ga0466694_101706_77_460 127
35 3300042594 Ga0466694_192808 Ga0466694_192808_864_1247 127
36 3300042599 Ga0466706_276437 Ga0466706_276437_1403_1786 127
37 3300042600 Ga0466700_077086 Ga0466700_077086_1108_1491 127
38 3300042608 Ga0466721_143418 Ga0466721_143418_508_891 127
39 3300042609 Ga0466722_010259 Ga0466722_010259_153_536 127
40 3300042609 Ga0466722_121292 Ga0466722_121292_1024_1407 127
41 3300042615 Ga0466711_098772 Ga0466711_098772_2719_3102 127
42 3300042617 Ga0466718_086913 Ga0466718_086913_721_1104 127
43 3300042656 Ga0466732_377951 Ga0466732_377951_266_649 127
44 iso_pr_bacteria 2590828840 2593257234 127
45 iso_pr_bacteria 2781125694 2781437262 127
46 iso_pr_bacteria 2820495292 2820496473 127
47 iso_pr_bacteria 2820727601 2820728783 127
48 iso_pr_bacteria 2820751898 2820751945 127
49 iso_pr_bacteria 2820776227 2820776829 127
50 iso_pr_bacteria 2940373808 2940374495 127
51 2225789004 2227097471 2227479328 128
52 3300000062 IMNBL1DRAFT_c0017810 IMNBL1DRAFT_00178103 128
53 3300002462 JGI24702J35022_10040328 JGI24702J35022_100403284 128
54 3300009826 Ga0123355_10998181 Ga0123355_109981811 128
55 3300010049 Ga0123356_10041965 Ga0123356_100419652 128
56 3300010049 Ga0123356_10237336 Ga0123356_102373362 128
57 3300010167 Ga0123353_11278236 Ga0123353_112782362 128
58 3300010167 Ga0123353_12159411 Ga0123353_121594112 128
59 3300010167 Ga0123353_12654656 Ga0123353_126546561 128
60 3300042595 Ga0466695_159436 Ga0466695_159436_6463_6849 128
61 3300042599 Ga0466706_287186 Ga0466706_287186_1609_1995 128
62 3300042605 Ga0466716_007228 Ga0466716_007228_6349_6735 128
63 3300042606 Ga0466719_217941 Ga0466719_217941_1933_2319 128
64 3300042613 Ga0466710_065032 Ga0466710_065032_786_1172 128
65 3300042616 Ga0466715_629769 Ga0466715_629769_15313_15699 128
66 3300042648 Ga0466709_160542 Ga0466709_160542_15260_15646 128
67 3300042648 Ga0466709_304600 Ga0466709_304600_43709_44095 128
68 3300042648 Ga0466709_390589 Ga0466709_390589_40734_41120 128
69 3300042649 Ga0466724_59132 Ga0466724_59132_62_448 128
70 3300042652 Ga0466708_233217 Ga0466708_233217_12336_12722 128
71 3300042656 Ga0466732_326694 Ga0466732_326694_8786_9172 128
72 3300000062 IMNBL1DRAFT_c0009898 IMNBL1DRAFT_00098984 129
73 3300000062 IMNBL1DRAFT_c0010471 IMNBL1DRAFT_00104712 129
74 3300000062 IMNBL1DRAFT_c0033758 IMNBL1DRAFT_00337583 129
75 3300000062 IMNBL1DRAFT_c0146348 IMNBL1DRAFT_01463481 129
76 3300002450 JGI24695J34938_10012543 JGI24695J34938_100125435 129
77 3300009826 Ga0123355_10196319 Ga0123355_101963193 129
78 3300009826 Ga0123355_10241259 Ga0123355_102412594 129
79 3300010049 Ga0123356_11866594 Ga0123356_118665941 129
80 3300042606 Ga0466719_318959 Ga0466719_318959_854_1243 129
81 3300042609 Ga0466722_180937 Ga0466722_180937_3146_3535 129
82 3300042613 Ga0466710_337220 Ga0466710_337220_165_554 129
83 3300042616 Ga0466715_268961 Ga0466715_268961_966_1355 129
84 3300042624 Ga0466735_180228 Ga0466735_180228_188_577 129
85 iso_pr_bacteria 2820303403 2820304496 129
86 iso_pr_bacteria 2820418027 2820418318 129
87 iso_pr_bacteria 2820432912 2820432981 129
88 iso_pr_bacteria 2820499546 2820501158 129
89 iso_pr_bacteria 2820530790 2820532018 129
90 iso_pr_bacteria 2820537337 2820538289 129
91 iso_pr_bacteria 2820681712 2820682221 129
92 3300002462 JGI24702J35022_10007838 JGI24702J35022_100078387 130
93 3300002462 JGI24702J35022_10127868 JGI24702J35022_101278682 130
94 3300009826 Ga0123355_10115208 Ga0123355_101152082 130
95 3300009826 Ga0123355_11004140 Ga0123355_110041401 130
96 3300010049 Ga0123356_11474219 Ga0123356_114742192 130
97 3300010049 Ga0123356_12525588 Ga0123356_125255881 130
98 3300010167 Ga0123353_10348748 Ga0123353_103487482 130
99 3300010167 Ga0123353_10926801 Ga0123353_109268012 130
100 3300010882 Ga0123354_10065743 Ga0123354_100657433 130
101 3300038395 Ga0415639_003875 Ga0415639_003875_17026_17418 130
102 3300042550 Ga0466656_014448 Ga0466656_014448_715_1107 130
103 3300042550 Ga0466656_360952 Ga0466656_360952_185_577 130
104 3300042595 Ga0466695_327353 Ga0466695_327353_944_1336 130
105 3300042598 Ga0466701_021930 Ga0466701_021930_3146_3538 130
106 3300042601 Ga0466707_040295 Ga0466707_040295_61526_61918 130
107 3300042602 Ga0466713_150340 Ga0466713_150340_40529_40921 130
108 3300042604 Ga0466717_189350 Ga0466717_189350_886_1278 130
109 3300042608 Ga0466721_045557 Ga0466721_045557_1063_1455 130
110 3300042608 Ga0466721_091208 Ga0466721_091208_765_1157 130
111 3300042622 Ga0466731_070587 Ga0466731_070587_1363_1755 130
112 3300042624 Ga0466735_156272 Ga0466735_156272_1011_1403 130
113 3300042636 Ga0466703_263516 Ga0466703_263516_881_1273 130
114 3300042654 Ga0466725_325951 Ga0466725_325951_709_1101 130
115 3300042659 Ga0466733_086518 Ga0466733_086518_3337_3729 130
116 iso_pr_bacteria 2820765201 2820765778 130
117 iso_pr_bacteria 3004677695 3004679318 130
118 3300002462 JGI24702J35022_10014829 JGI24702J35022_100148293 131
119 3300002462 JGI24702J35022_10025136 JGI24702J35022_100251364 131
120 3300002462 JGI24702J35022_10048832 JGI24702J35022_100488321 131
121 3300005201 Ga0072941_1097719 Ga0072941_10977192 131
122 3300010167 Ga0123353_10016386 Ga0123353_100163866 131
123 3300010167 Ga0123353_11179017 Ga0123353_111790172 131
124 3300042599 Ga0466706_113834 Ga0466706_113834_9649_10044 131
125 3300042599 Ga0466706_164885 Ga0466706_164885_1699_2094 131
126 3300042599 Ga0466706_184233 Ga0466706_184233_3620_4015 131
127 3300042603 Ga0466714_125023 Ga0466714_125023_521_916 131
128 iso_pr_bacteria 2820767225 2820768091 131
129 iso_pr_bacteria 2820772500 2820773987 131
130 3300000062 IMNBL1DRAFT_c0002916 IMNBL1DRAFT_00029166 132
131 3300002462 JGI24702J35022_10020219 JGI24702J35022_100202194 132
132 3300010049 Ga0123356_12758301 Ga0123356_127583012 132
133 3300010049 Ga0123356_12960233 Ga0123356_129602332 132
134 3300010167 Ga0123353_10084622 Ga0123353_100846225 132
135 3300010167 Ga0123353_13134436 Ga0123353_131344361 132
136 3300042597 Ga0466699_233800 Ga0466699_233800_1853_2251 132
137 3300042597 Ga0466699_395697 Ga0466699_395697_2405_2803 132
138 3300042601 Ga0466707_265399 Ga0466707_265399_42733_43131 132
139 3300042636 Ga0466703_339680 Ga0466703_339680_1282_1680 132
140 3300021227 Ga0223688_1013139 Ga0223688_10131391 133
141 3300042654 Ga0466725_056525 Ga0466725_056525_4943_5344 133
142 3300042659 Ga0466733_197328 Ga0466733_197328_509_910 133
143 3300009784 Ga0123357_10000228 Ga0123357_1000022849 134
144 3300010049 Ga0123356_12093606 Ga0123356_120936061 134
145 3300010167 Ga0123353_10040048 Ga0123353_100400488 134
146 3300010167 Ga0123353_10196556 Ga0123353_101965561 134
147 iso_pr_bacteria 2820619171 2820619209 134
148 3300009826 Ga0123355_10000458 Ga0123355_1000045840 135
149 3300010049 Ga0123356_12257986 Ga0123356_122579861 135
150 3300042595 Ga0466695_381454 Ga0466695_381454_315_722 135
151 3300042600 Ga0466700_077487 Ga0466700_077487_90_497 135
152 3300042602 Ga0466713_135203 Ga0466713_135203_448_855 135
153 3300042616 Ga0466715_060803 Ga0466715_060803_2042_2449 135
154 3300010167 Ga0123353_11304252 Ga0123353_113042522 136
155 3300002508 JGI24700J35501_10929075 JGI24700J35501_109290752 139
156 3300042602 Ga0466713_036401 Ga0466713_036401_22569_22997 142
157 3300042599 Ga0466706_116238 Ga0466706_116238_963_1400 145
158 3300042600 Ga0466700_029793 Ga0466700_029793_546_998 150
159 3300042595 Ga0466695_148009 Ga0466695_148009_56_562 168

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03061 4HBT Thioesterase superfamily 46 110 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.