Protein Family IF05704

Metagenome Isolate
252 Members
133 Samples
178 Scaffolds
55.97 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_284770|Ga0466706_284770_1953_2153
Length
66 aa
Sequence
VTGEERFVNKLASKAADVRPKITLACTVCKERNYITKKNRRNDPNRMELNKFCPRCGKHTPHRESR

📊 Sample Types

Isolate 29.4%
Metagenome 70.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 30.4%
Termitidae 25.6%
Formicidae 12.0%
Kalotermitidae 8.8%
Culicidae 4.0%
Elmidae 3.2%
Tenebrionidae 2.4%
Termopsidae 2.4%
Hydrophilidae 1.6%
Cambaridae 1.6%
Rhinotermitidae 1.6%
Thomisidae 0.8%
Hodotermitidae 0.8%
Cimicidae 0.8%
Reduviidae 0.8%
Armadillidiidae 0.8%
Cerambycidae 0.8%
Curculionidae 0.8%
Siricidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 216
Eukaryota 0
Viruses 0
Unclassified 36

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
2 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
3 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
4 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
5 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
6 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
7 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
8 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
9 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
10 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
13 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
14 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
15 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
20 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
24 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
25 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
26 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
27 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
28 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
29 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
32 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
33 8062637095 Yimella sp. cx-51 Isolate Cambaridae
34 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
35 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
40 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
41 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
42 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
43 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
44 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
45 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
46 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
47 2900368070 Nocardia aurantia RB56 Isolate Termitidae
48 2912749649 Streptomyces sp. GS7 Isolate Termitidae
49 8062747827 Yimella sp. cx-51 Isolate Cambaridae
50 3006461590 Streptomyces sp. RB5 Isolate Termitidae
51 3006667155 Streptomyces sp. SID9727 Isolate
52 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
53 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
54 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
55 2547132081 Streptomyces sp. S4 Isolate Formicidae
56 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
57 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
58 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
59 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
60 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
61 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
62 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
63 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
64 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
65 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
66 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
67 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
68 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
69 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
70 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
71 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
72 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
73 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
74 2862784999 Streptomyces sp. M41 Isolate Unclassified
75 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
76 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
77 2931425734 Nocardioides sp. J2M5 Isolate
78 2931430189 Tessaracoccus palaemonis J1M15 Isolate
79 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
80 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
81 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
82 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
83 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
84 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
85 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
86 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
87 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
88 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
89 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
90 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
91 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
92 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
93 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
94 2908241010 Streptomyces sp. HF10 Isolate Termitidae
95 2912817845 Streptomyces griseus SID164 Isolate
96 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
97 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
98 3006468911 Streptomyces sp. RB17 Isolate Termitidae
99 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
100 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
101 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
102 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
103 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
104 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
105 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
106 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
107 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
108 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
109 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
110 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
111 2896955351 Streptomyces sp. GF20 Isolate Termitidae
112 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
113 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
114 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
115 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
116 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
117 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
118 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
119 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
120 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
121 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
122 2820840446 Unclassified Actinobacteria Lab288P4bin17 Isolate Unclassified
123 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
124 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
125 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
126 2873603790 Tessaracoccus coleopterorum HDW20 Isolate Hydrophilidae
127 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
128 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
129 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
130 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
131 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
132 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
133 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_132300 3300042611 Bacteria 17122
2 Ga0466705_084516 3300042612 Bacteria 2585
3 Ga0466706_284770 3300042599 Bacteria 25134
4 Ga0466707_072356 3300042601 Unclassified 5140
5 Ga0466713_013806 3300042602 Bacteria 13196
6 Ga0123357_10408985 3300009784 Bacteria 1225
7 Ga0123357_10640935 3300009784 Bacteria 792
8 Ga0123357_11015765 3300009784 Bacteria 513
9 Ga0123356_10001142 3300010049 Bacteria 29321
10 Ga0123353_10125571 3300010167 Bacteria 4123
11 JGI24699J35502_11133323 3300002509 Bacteria 9847
12 Ga0466729_255004 3300042621 Bacteria 2267
13 Ga0466729_281877 3300042621 Bacteria 4103
14 Ga0466730_048478 3300042625 Bacteria 1529
15 Ga0466703_139568 3300042636 Unclassified 1260
16 Ga0466703_265965 3300042636 Bacteria 8915
17 Ga0466708_144841 3300042652 Bacteria 18318
18 Ga0466733_073785 3300042659 Bacteria 65598
19 Ga0466707_061285 3300042601 Bacteria 45531
20 Ga0466707_330867 3300042601 Bacteria 5808
21 Ga0466707_413335 3300042601 Bacteria 3584
22 Ga0466713_092579 3300042602 Bacteria 53429
23 Ga0466717_250013 3300042604 Bacteria 1689
24 Ga0123356_10000385 3300010049 Bacteria 50352
25 Ga0123353_10000342 3300010167 Bacteria 56902
26 Ga0123353_10004418 3300010167 Bacteria 18110
27 Ga0123353_10915114 3300010167 Bacteria 1192
28 Ga0123354_10987135 3300010882 Unclassified 543
29 Ga0123354_11012585 3300010882 Unclassified 533
30 Ga0466710_309900 3300042613 Unclassified 1825
31 Ga0466723_189822 3300042618 Bacteria 8337
32 Ga0466723_232110 3300042618 Bacteria 32041
33 Ga0160472_100006 3300012839 Bacteria 656551
34 Ga0068305_10146797 3300005083 Bacteria 617
35 Ga0466735_234952 3300042624 Bacteria 1479
36 Ga0466697_077161 3300042611 Bacteria 1050
37 Ga0466705_152139 3300042612 Unclassified 4604
38 Ga0466705_283107 3300042612 Unclassified 2182
39 Ga0466706_267798 3300042599 Bacteria 2502
40 Ga0466707_271863 3300042601 Bacteria 41261
41 Ga0466716_530273 3300042605 Bacteria 10198
42 Ga0466722_207962 3300042609 Bacteria 22815
43 Ga0123357_10012972 3300009784 Bacteria 10775
44 Ga0123357_10057054 3300009784 Bacteria 5249
45 Ga0123356_10074791 3300010049 Bacteria 3189
46 Ga0123353_10937477 3300010167 Unclassified 1173
47 Ga0123353_11154832 3300010167 Bacteria 1022
48 Ga0466723_015044 3300042618 Bacteria 2515
49 Ga0466728_245094 3300042620 Bacteria 2545
50 Ga0160432_100214 3300012818 Bacteria 49653
51 Ga0160448_105940 3300012854 Bacteria 3117
52 Ga0160436_1024835 3300012861 Unclassified 1082
53 Ga0466696_440867 3300042596 Bacteria 2425
54 AustNasuHG_c1000390 3300000089 Bacteria 15232
55 JGI24705J35276_12209033 3300002504 Bacteria 1788
56 JGI24699J35502_10983983 3300002509 Bacteria 1283
57 Ga0072941_1074101 3300005201 Bacteria 8389
58 Ga0466734_045243 3300042623 Bacteria 1208
59 Ga0466703_329734 3300042636 Bacteria 2228
60 Ga0466727_002417 3300042655 Unclassified 1151
61 Ga0562378_0002 3300056814 Bacteria 3519472
62 Ga0466706_253929 3300042599 Bacteria 2939
63 Ga0466700_393834 3300042600 Bacteria 18150
64 Ga0466707_086104 3300042601 Bacteria 138731
65 Ga0466713_047718 3300042602 Bacteria 1968
66 Ga0466713_089995 3300042602 Bacteria 18549
67 Ga0466713_123761 3300042602 Bacteria 17729
68 Ga0466719_253393 3300042606 Bacteria 10757
69 Ga0466698_061748 3300042610 Bacteria 3613
70 Ga0466657_031058 3300042582 Bacteria 11387
71 Ga0466691_200516 3300042593 Unclassified 14178
72 JGI24705J35276_12221296 3300002504 Bacteria 2329
73 JGI24699J35502_10350660 3300002509 Bacteria 540
74 JGI24699J35502_11040471 3300002509 Unclassified 1572
75 JGI24699J35502_11134164 3300002509 Bacteria 41878
76 Ga0123357_10000204 3300009784 Bacteria 55847
77 Ga0123357_10003109 3300009784 Bacteria 18848
78 Ga0466729_220036 3300042621 Bacteria 1863
79 Ga0466734_076893 3300042623 Bacteria 1139
80 Ga0466730_068856 3300042625 Bacteria 20075
81 Ga0466703_166237 3300042636 Bacteria 199031
82 Ga0466703_417632 3300042636 Bacteria 1158
83 Ga0466704_561041 3300042643 Unclassified 5702
84 Ga0466727_172181 3300042655 Unclassified 11245
85 Ga0466733_063884 3300042659 Bacteria 94180
86 Ga0466713_072111 3300042602 Bacteria 1427
87 Ga0466713_103136 3300042602 Bacteria 1970
88 Ga0123357_10900145 3300009784 Unclassified 572
89 Ga0123356_11672103 3300010049 Bacteria 789
90 Ga0123353_10782170 3300010167 Bacteria 1322
91 Ga0123354_10003538 3300010882 Bacteria 21629
92 Ga0123354_10110509 3300010882 Unclassified 3634
93 Ga0466705_432267 3300042612 Bacteria 8713
94 Ga0466710_421170 3300042613 Bacteria 1581
95 Ga0466726_478976 3300042619 Bacteria 1155
96 Ga0466728_220739 3300042620 Bacteria 4314
97 Ga0466691_095906 3300042593 Bacteria 7344
98 Ga0466696_253023 3300042596 Bacteria 8455
99 AglaG_F499EG101EFG2Q 2084038013 Bacteria 520
100 JGI24702J35022_10843969 3300002462 Bacteria 571
101 JGI24703J35330_11743688 3300002501 Bacteria 3962
102 Ga0466729_214193 3300042621 Bacteria 1604
103 Ga0466730_018891 3300042625 Bacteria 23265
104 Ga0466703_274039 3300042636 Bacteria 31452
105 Ga0466703_403617 3300042636 Bacteria 11020
106 Ga0466725_402376 3300042654 Unclassified 2499
107 Ga0466727_270436 3300042655 Bacteria 3965
108 Ga0466705_363018 3300042612 Bacteria 2039
109 Ga0466707_274722 3300042601 Bacteria 1315
110 Ga0466707_334896 3300042601 Bacteria 10519
111 Ga0466713_088039 3300042602 Bacteria 7289
112 Ga0466713_105765 3300042602 Bacteria 92337
113 Ga0123356_10001023 3300010049 Bacteria 31111
114 Ga0123356_10113504 3300010049 Bacteria 2621
115 Ga0123353_12897561 3300010167 Unclassified 559
116 Ga0160464_104394 3300012805 Bacteria 1785
117 Ga0466710_008400 3300042613 Bacteria 6826
118 Ga0466715_017612 3300042616 Bacteria 40510
119 Ga0466715_607475 3300042616 Bacteria 1159
120 Ga0466723_041651 3300042618 Bacteria 2668
121 Ga0466723_240349 3300042618 Unclassified 9476
122 Ga0466728_116348 3300042620 Bacteria 1315
123 Ga0160431_110899 3300012828 Bacteria 1113
124 Ga0466696_127504 3300042596 Bacteria 2594
125 AustNasuHG_c1022427 3300000089 Unclassified 2028
126 JGI24699J35502_11129824 3300002509 Unclassified 4849
127 Ga0072940_1463781 3300005200 Bacteria 1658
128 Ga0123357_10000192 3300009784 Bacteria 57301
129 Ga0466704_285231 3300042643 Bacteria 1371
130 Ga0466704_311098 3300042643 Bacteria 76427
131 Ga0466724_33972 3300042649 Bacteria 12208
132 Ga0466727_263974 3300042655 Bacteria 1110
133 Ga0466713_149114 3300042602 Bacteria 5374
134 Ga0466716_130090 3300042605 Unclassified 2672
135 Ga0466719_016723 3300042606 Bacteria 32213
136 Ga0466719_479281 3300042606 Bacteria 3337
137 Ga0123355_11174152 3300009826 Unclassified 787
138 Ga0123356_10431275 3300010049 Bacteria 1462
139 Ga0123353_11671684 3300010167 Bacteria 799
140 Ga0123354_10637455 3300010882 Bacteria 766
141 Ga0466718_072760 3300042617 Bacteria 6152
142 Ga0466723_096308 3300042618 Bacteria 2562
143 Ga0466723_126758 3300042618 Bacteria 3812
144 Ga0160456_100508 3300012820 Unclassified 12100
145 AustNasuHG_c1026536 3300000089 Unclassified 1802
146 AustNasuHG_c1057886 3300000089 Bacteria 770
147 Ga0072940_1017776 3300005200 Bacteria 2823
148 Ga0466734_132566 3300042623 Bacteria 1128
149 Ga0466733_005323 3300042659 Unclassified 10701
150 Ga0562375_2354 3300056856 Bacteria 21387
151 Ga0466706_184764 3300042599 Bacteria 20406
152 Ga0466707_330538 3300042601 Unclassified 1503
153 Ga0123357_10006708 3300009784 Bacteria 14107
154 Ga0123357_10096898 3300009784 Bacteria 3819
155 Ga0123355_11935262 3300009826 Bacteria 550
156 Ga0123356_10164638 3300010049 Bacteria 2220
157 Ga0123356_11092051 3300010049 Unclassified 966
158 Ga0123353_12365915 3300010167 Unclassified 636
159 Ga0123354_10072315 3300010882 Unclassified 4967
160 Ga0123354_10220096 3300010882 Bacteria 2020
161 Ga0466723_178656 3300042618 Bacteria 5158
162 Ga0466728_165156 3300042620 Bacteria 2325
163 Ga0466729_100524 3300042621 Bacteria 1092
164 Ga0160459_111976 3300012831 Unclassified 1019
165 Ga0160447_101409 3300012849 Unclassified 9382
166 Ga0466693_197064 3300042592 Bacteria 94166
167 Ga0466696_435006 3300042596 Unclassified 1610
168 JGI24699J35502_10846861 3300002509 Bacteria 948
169 JGI24699J35502_11014796 3300002509 Unclassified 1419
170 JGI24696J40584_12271962 3300002834 Bacteria 510
171 Ga0074263_116363 3300005485 Unclassified 773
172 Ga0466734_106881 3300042623 Bacteria 3494
173 Ga0466734_154847 3300042623 Bacteria 1244
174 Ga0466730_088707 3300042625 Unclassified 3142
175 Ga0466703_135101 3300042636 Bacteria 119691
176 Ga0466704_034783 3300042643 Bacteria 163660
177 Ga0466708_049949 3300042652 Bacteria 5143
178 Ga0466725_220402 3300042654 Bacteria 4516

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042611 Ga0466697_132300 Ga0466697_132300_73_237 54
2 3300042613 Ga0466710_008400 Ga0466710_008400_2503_2667 54
3 3300042613 Ga0466710_421170 Ga0466710_421170_363_527 54
4 3300042625 Ga0466730_018891 Ga0466730_018891_8683_8847 54
5 3300042625 Ga0466730_048478 Ga0466730_048478_379_543 54
6 3300042625 Ga0466730_068856 Ga0466730_068856_3684_3848 54
7 3300042625 Ga0466730_088707 Ga0466730_088707_719_883 54
8 iso_pr_bacteria 2515154100 2515556433 54
9 iso_pr_bacteria 2515154104 2515585806 54
10 iso_pr_bacteria 2515154106 2515605414 54
11 iso_pr_bacteria 2523533511 2523591798 54
12 iso_pr_bacteria 2547132081 2547292742 54
13 iso_pr_bacteria 2648501322 2649448524 54
14 iso_pr_bacteria 2772190761 2772885674 54
15 iso_pr_bacteria 2820857933 2820858854 54
16 iso_pr_bacteria 2820903739 2820904647 54
17 iso_pr_bacteria 2856652821 2856656969 54
18 iso_pr_bacteria 2862784999 2862787491 54
19 iso_pr_bacteria 2873196663 2873203617 54
20 iso_pr_bacteria 2896955351 2896957780 54
21 iso_pr_bacteria 2908241010 2908245332 54
22 iso_pr_bacteria 2912749649 2912750101 54
23 iso_pr_bacteria 2912817845 2912818239 54
24 iso_pr_bacteria 3006461590 3006462715 54
25 iso_pr_bacteria 3006468911 3006474063 54
26 iso_pr_bacteria 3006667155 3006673345 54
27 iso_pr_bacteria 647000328 647324225 54
28 iso_pr_bacteria 8046957834 8046958499 54
29 iso_pr_bacteria 8053361298 8053362054 54
30 iso_pr_bacteria 8077783556 8077785878 54
31 3300009784 Ga0123357_10006708 Ga0123357_1000670812 55
32 3300009784 Ga0123357_11015765 Ga0123357_110157652 55
33 3300009826 Ga0123355_11174152 Ga0123355_111741522 55
34 3300010049 Ga0123356_11672103 Ga0123356_116721032 55
35 3300010167 Ga0123353_10004418 Ga0123353_100044185 55
36 3300010167 Ga0123353_10782170 Ga0123353_107821704 55
37 3300010167 Ga0123353_11154832 Ga0123353_111548322 55
38 3300010882 Ga0123354_10637455 Ga0123354_106374552 55
39 3300010882 Ga0123354_10987135 Ga0123354_109871352 55
40 3300012820 Ga0160456_100508 Ga0160456_1005083 55
41 3300012831 Ga0160459_111976 Ga0160459_1119762 55
42 3300012854 Ga0160448_105940 Ga0160448_1059404 55
43 3300042649 Ga0466724_33972 Ga0466724_33972_7262_7429 55
44 iso_pr_bacteria 2545824723 2546569980 55
45 iso_pr_bacteria 2547132042 2547178340 55
46 iso_pr_bacteria 2630969010 2634126037 55
47 iso_pr_bacteria 2671180625 2673536500 55
48 iso_pr_bacteria 2675903013 2676274136 55
49 iso_pr_bacteria 2675903497 2678199061 55
50 iso_pr_bacteria 2852016966 2852018995 55
51 iso_pr_bacteria 2856671350 2856675490 55
52 iso_pr_bacteria 2856882415 2856886875 55
53 iso_pr_bacteria 2856947901 2856950464 55
54 iso_pr_bacteria 2856954254 2856954939 55
55 iso_pr_bacteria 2856960404 2856964862 55
56 iso_pr_bacteria 2856966858 2856969594 55
57 iso_pr_bacteria 2856973192 2856974516 55
58 iso_pr_bacteria 2859970369 2859975131 55
59 iso_pr_bacteria 2863397684 2863399713 55
60 iso_pr_bacteria 2864773010 2864774142 55
61 iso_pr_bacteria 2864899338 2864899673 55
62 iso_pr_bacteria 2864918810 2864921640 55
63 iso_pr_bacteria 2864964650 2864966264 55
64 iso_pr_bacteria 2873589062 2873589251 55
65 iso_pr_bacteria 646564587 646803567 55
66 iso_pr_bacteria 8077775691 8077776337 55
67 iso_pr_bacteria 8109397740 8109401003 55
68 2084038013 AglaG_F499EG101EFG2Q AglaG_00512710 56
69 3300005083 Ga0068305_10146797 Ga0068305_101467972 56
70 3300010049 Ga0123356_10431275 Ga0123356_104312753 56
71 3300010167 Ga0123353_12897561 Ga0123353_128975612 56
72 3300012805 Ga0160464_104394 Ga0160464_1043945 56
73 3300042582 Ga0466657_031058 Ga0466657_031058_3522_3692 56
74 3300042592 Ga0466693_197064 Ga0466693_197064_84851_85021 56
75 3300042593 Ga0466691_095906 Ga0466691_095906_3873_4043 56
76 3300042593 Ga0466691_200516 Ga0466691_200516_10932_11102 56
77 3300042596 Ga0466696_127504 Ga0466696_127504_83_253 56
78 3300042596 Ga0466696_253023 Ga0466696_253023_4315_4485 56
79 3300042596 Ga0466696_435006 Ga0466696_435006_1167_1337 56
80 3300042596 Ga0466696_440867 Ga0466696_440867_116_286 56
81 3300042599 Ga0466706_184764 Ga0466706_184764_2624_2794 56
82 3300042599 Ga0466706_253929 Ga0466706_253929_1237_1407 56
83 3300042599 Ga0466706_267798 Ga0466706_267798_436_606 56
84 3300042600 Ga0466700_393834 Ga0466700_393834_15712_15882 56
85 3300042601 Ga0466707_061285 Ga0466707_061285_29996_30166 56
86 3300042601 Ga0466707_072356 Ga0466707_072356_3048_3218 56
87 3300042601 Ga0466707_086104 Ga0466707_086104_39032_39202 56
88 3300042601 Ga0466707_271863 Ga0466707_271863_39262_39432 56
89 3300042601 Ga0466707_274722 Ga0466707_274722_257_427 56
90 3300042601 Ga0466707_330538 Ga0466707_330538_1199_1369 56
91 3300042601 Ga0466707_330867 Ga0466707_330867_3342_3512 56
92 3300042601 Ga0466707_334896 Ga0466707_334896_5392_5562 56
93 3300042601 Ga0466707_413335 Ga0466707_413335_2268_2438 56
94 3300042602 Ga0466713_013806 Ga0466713_013806_11090_11260 56
95 3300042602 Ga0466713_072111 Ga0466713_072111_1005_1175 56
96 3300042602 Ga0466713_088039 Ga0466713_088039_6984_7154 56
97 3300042602 Ga0466713_089995 Ga0466713_089995_9681_9851 56
98 3300042602 Ga0466713_092579 Ga0466713_092579_26131_26301 56
99 3300042602 Ga0466713_103136 Ga0466713_103136_346_516 56
100 3300042602 Ga0466713_105765 Ga0466713_105765_88419_88589 56
101 3300042602 Ga0466713_123761 Ga0466713_123761_16257_16427 56
102 3300042602 Ga0466713_149114 Ga0466713_149114_19_189 56
103 3300042604 Ga0466717_250013 Ga0466717_250013_162_332 56
104 3300042605 Ga0466716_130090 Ga0466716_130090_1964_2134 56
105 3300042605 Ga0466716_530273 Ga0466716_530273_3409_3579 56
106 3300042606 Ga0466719_253393 Ga0466719_253393_8986_9156 56
107 3300042606 Ga0466719_479281 Ga0466719_479281_2586_2756 56
108 3300042609 Ga0466722_207962 Ga0466722_207962_21732_21902 56
109 3300042610 Ga0466698_061748 Ga0466698_061748_2626_2796 56
110 3300042611 Ga0466697_077161 Ga0466697_077161_325_495 56
111 3300042612 Ga0466705_084516 Ga0466705_084516_1400_1570 56
112 3300042612 Ga0466705_152139 Ga0466705_152139_2209_2379 56
113 3300042612 Ga0466705_283107 Ga0466705_283107_1956_2126 56
114 3300042612 Ga0466705_363018 Ga0466705_363018_625_795 56
115 3300042612 Ga0466705_432267 Ga0466705_432267_484_654 56
116 3300042613 Ga0466710_309900 Ga0466710_309900_674_844 56
117 3300042616 Ga0466715_607475 Ga0466715_607475_364_534 56
118 3300042617 Ga0466718_072760 Ga0466718_072760_2553_2723 56
119 3300042618 Ga0466723_015044 Ga0466723_015044_566_736 56
120 3300042618 Ga0466723_041651 Ga0466723_041651_1166_1336 56
121 3300042618 Ga0466723_096308 Ga0466723_096308_2010_2180 56
122 3300042618 Ga0466723_126758 Ga0466723_126758_722_892 56
123 3300042618 Ga0466723_178656 Ga0466723_178656_3230_3400 56
124 3300042618 Ga0466723_189822 Ga0466723_189822_424_594 56
125 3300042618 Ga0466723_232110 Ga0466723_232110_13723_13893 56
126 3300042618 Ga0466723_240349 Ga0466723_240349_1409_1579 56
127 3300042619 Ga0466726_478976 Ga0466726_478976_35_205 56
128 3300042620 Ga0466728_116348 Ga0466728_116348_646_816 56
129 3300042620 Ga0466728_165156 Ga0466728_165156_1711_1881 56
130 3300042620 Ga0466728_220739 Ga0466728_220739_3893_4063 56
131 3300042620 Ga0466728_245094 Ga0466728_245094_83_253 56
132 3300042621 Ga0466729_100524 Ga0466729_100524_149_319 56
133 3300042621 Ga0466729_214193 Ga0466729_214193_760_930 56
134 3300042621 Ga0466729_220036 Ga0466729_220036_448_618 56
135 3300042621 Ga0466729_255004 Ga0466729_255004_350_520 56
136 3300042621 Ga0466729_281877 Ga0466729_281877_227_397 56
137 3300042623 Ga0466734_045243 Ga0466734_045243_549_719 56
138 3300042623 Ga0466734_076893 Ga0466734_076893_204_374 56
139 3300042623 Ga0466734_106881 Ga0466734_106881_2409_2579 56
140 3300042623 Ga0466734_132566 Ga0466734_132566_355_525 56
141 3300042623 Ga0466734_154847 Ga0466734_154847_182_352 56
142 3300042624 Ga0466735_234952 Ga0466735_234952_540_710 56
143 3300042636 Ga0466703_135101 Ga0466703_135101_4593_4763 56
144 3300042636 Ga0466703_139568 Ga0466703_139568_636_806 56
145 3300042636 Ga0466703_166237 Ga0466703_166237_84475_84645 56
146 3300042636 Ga0466703_265965 Ga0466703_265965_8291_8461 56
147 3300042636 Ga0466703_274039 Ga0466703_274039_28884_29054 56
148 3300042636 Ga0466703_329734 Ga0466703_329734_283_453 56
149 3300042636 Ga0466703_403617 Ga0466703_403617_2486_2656 56
150 3300042636 Ga0466703_417632 Ga0466703_417632_413_583 56
151 3300042643 Ga0466704_034783 Ga0466704_034783_153564_153734 56
152 3300042643 Ga0466704_285231 Ga0466704_285231_880_1050 56
153 3300042643 Ga0466704_311098 Ga0466704_311098_32814_32984 56
154 3300042643 Ga0466704_561041 Ga0466704_561041_2557_2727 56
155 3300042652 Ga0466708_049949 Ga0466708_049949_1166_1336 56
156 3300042652 Ga0466708_144841 Ga0466708_144841_7017_7187 56
157 3300042654 Ga0466725_220402 Ga0466725_220402_3993_4163 56
158 3300042654 Ga0466725_402376 Ga0466725_402376_1317_1487 56
159 3300042655 Ga0466727_002417 Ga0466727_002417_610_780 56
160 3300042655 Ga0466727_172181 Ga0466727_172181_6642_6812 56
161 3300042655 Ga0466727_263974 Ga0466727_263974_107_277 56
162 3300042655 Ga0466727_270436 Ga0466727_270436_1826_1996 56
163 3300042659 Ga0466733_005323 Ga0466733_005323_6220_6390 56
164 3300042659 Ga0466733_063884 Ga0466733_063884_71957_72127 56
165 3300042659 Ga0466733_073785 Ga0466733_073785_45742_45912 56
166 3300056814 Ga0562378_0002 Ga0562378_0002_1280169_1280339 56
167 3300056856 Ga0562375_2354 Ga0562375_2354_16329_16499 56
168 iso_pr_bacteria 2820807258 2820808466 56
169 iso_pr_bacteria 2820814774 2820814815 56
170 iso_pr_bacteria 2820816657 2820817606 56
171 iso_pr_bacteria 2820818506 2820819611 56
172 iso_pr_bacteria 2820825283 2820826938 56
173 iso_pr_bacteria 2820829137 2820831082 56
174 iso_pr_bacteria 2820834831 2820836445 56
175 iso_pr_bacteria 2820838073 2820838761 56
176 iso_pr_bacteria 2820840446 2820842026 56
177 iso_pr_bacteria 2820842553 2820844638 56
178 iso_pr_bacteria 2820849606 2820850131 56
179 iso_pr_bacteria 2820867525 2820869352 56
180 iso_pr_bacteria 2820897376 2820897646 56
181 iso_pr_bacteria 2820899690 2820900724 56
182 iso_pr_bacteria 2820901319 2820903053 56
183 iso_pr_bacteria 2820914081 2820914097 56
184 iso_pr_bacteria 2820922474 2820923181 56
185 iso_pr_bacteria 2820926697 2820928860 56
186 iso_pr_bacteria 2820944107 2820945027 56
187 iso_pr_bacteria 2821314491 2821316623 56
188 iso_pr_bacteria 2873603790 2873605180 56
189 iso_pr_bacteria 2900368070 2900370177 56
190 iso_pr_bacteria 2931425734 2931429286 56
191 iso_pr_bacteria 2931430189 2931432329 56
192 iso_pr_bacteria 8030347546 8030347952 56
193 iso_pr_bacteria 8062637095 8062639559 56
194 iso_pr_bacteria 8062747827 8062748352 56
195 3300000089 AustNasuHG_c1000390 AustNasuHG_100039011 57
196 3300000089 AustNasuHG_c1022427 AustNasuHG_10224273 57
197 3300000089 AustNasuHG_c1026536 AustNasuHG_10265362 57
198 3300000089 AustNasuHG_c1057886 AustNasuHG_10578862 57
199 3300002462 JGI24702J35022_10843969 JGI24702J35022_108439692 57
200 3300002501 JGI24703J35330_11743688 JGI24703J35330_117436885 57
201 3300002504 JGI24705J35276_12209033 JGI24705J35276_122090334 57
202 3300002504 JGI24705J35276_12221296 JGI24705J35276_122212962 57
203 3300002509 JGI24699J35502_10350660 JGI24699J35502_103506601 57
204 3300002509 JGI24699J35502_10846861 JGI24699J35502_108468611 57
205 3300002509 JGI24699J35502_10983983 JGI24699J35502_109839832 57
206 3300002509 JGI24699J35502_11014796 JGI24699J35502_110147962 57
207 3300002509 JGI24699J35502_11040471 JGI24699J35502_110404711 57
208 3300002509 JGI24699J35502_11129824 JGI24699J35502_111298245 57
209 3300002509 JGI24699J35502_11133323 JGI24699J35502_111333232 57
210 3300002509 JGI24699J35502_11134164 JGI24699J35502_1113416439 57
211 3300002834 JGI24696J40584_12271962 JGI24696J40584_122719622 57
212 3300005200 Ga0072940_1017776 Ga0072940_10177763 57
213 3300005200 Ga0072940_1463781 Ga0072940_14637813 57
214 3300005201 Ga0072941_1074101 Ga0072941_10741019 57
215 3300005485 Ga0074263_116363 Ga0074263_1163632 57
216 3300009784 Ga0123357_10000192 Ga0123357_1000019227 57
217 3300009784 Ga0123357_10000204 Ga0123357_1000020413 57
218 3300009784 Ga0123357_10003109 Ga0123357_1000310915 57
219 3300009784 Ga0123357_10012972 Ga0123357_100129723 57
220 3300009784 Ga0123357_10057054 Ga0123357_100570548 57
221 3300009784 Ga0123357_10096898 Ga0123357_100968983 57
222 3300009784 Ga0123357_10408985 Ga0123357_104089852 57
223 3300009784 Ga0123357_10640935 Ga0123357_106409352 57
224 3300009784 Ga0123357_10900145 Ga0123357_109001451 57
225 3300009826 Ga0123355_11935262 Ga0123355_119352622 57
226 3300010049 Ga0123356_10000385 Ga0123356_1000038521 57
227 3300010049 Ga0123356_10001023 Ga0123356_1000102316 57
228 3300010049 Ga0123356_10001142 Ga0123356_100011425 57
229 3300010049 Ga0123356_10074791 Ga0123356_100747916 57
230 3300010049 Ga0123356_10113504 Ga0123356_101135044 57
231 3300010049 Ga0123356_10164638 Ga0123356_101646384 57
232 3300010049 Ga0123356_11092051 Ga0123356_110920512 57
233 3300010167 Ga0123353_10000342 Ga0123353_1000034227 57
234 3300010167 Ga0123353_10125571 Ga0123353_101255713 57
235 3300010167 Ga0123353_10915114 Ga0123353_109151143 57
236 3300010167 Ga0123353_10937477 Ga0123353_109374772 57
237 3300010167 Ga0123353_11671684 Ga0123353_116716842 57
238 3300010167 Ga0123353_12365915 Ga0123353_123659152 57
239 3300010882 Ga0123354_10003538 Ga0123354_1000353812 57
240 3300010882 Ga0123354_10072315 Ga0123354_100723156 57
241 3300010882 Ga0123354_10110509 Ga0123354_101105094 57
242 3300010882 Ga0123354_10220096 Ga0123354_102200963 57
243 3300010882 Ga0123354_11012585 Ga0123354_110125851 57
244 3300012818 Ga0160432_100214 Ga0160432_10021415 57
245 3300012828 Ga0160431_110899 Ga0160431_1108992 57
246 3300012839 Ga0160472_100006 Ga0160472_100006575 57
247 3300012849 Ga0160447_101409 Ga0160447_10140911 57
248 3300012861 Ga0160436_1024835 Ga0160436_10248354 57
249 3300042606 Ga0466719_016723 Ga0466719_016723_12908_13087 59
250 3300042616 Ga0466715_017612 Ga0466715_017612_259_438 59
251 3300042599 Ga0466706_284770 Ga0466706_284770_1953_2153 66
252 3300042602 Ga0466713_047718 Ga0466713_047718_1519_1749 76

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00471 Ribosomal_L33 Ribosomal protein L33 21 66 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.53 0.69 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.