Protein Family IF05693

Metagenome Isolate
183 Members
76 Samples
151 Scaffolds
227.07 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_257089|Ga0466706_257089_327_1121
Length
264 aa
Sequence
VALPQGSKHPPTAVGTLFSKEGKGRGGIALSLKGAYSMYKMLVVDDEERIRELIKKYAVFEGHEVTEAADGMEAVALCRDTAFDILIMDVMMPELDGFSAVKEIRKKSAVPVIMLSARGEEYDRIHGFEAGVDDYVVKPFSPKELMLRVEAVMKRVRLSGDSGGEDAHETFIHRGLTVDFTARLVYVDGERVELSPKEYDLLFFLVKNRNIALPRGKLLTEVWGYDFYGDDRTLDTHIKLLRKSLGEYSTCIVTLRGTGYRFDA

📊 Sample Types

Isolate 17.5%
Metagenome 82.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.8%
Unclassified 24.3%
Blattidae 16.2%
Kalotermitidae 12.2%
Rhinotermitidae 4.1%
Termopsidae 4.1%
Passalidae 2.7%
Stratiomyidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 178
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
2 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
3 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
4 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
5 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
16 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
17 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
23 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
24 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
25 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
26 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
27 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
28 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
29 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
30 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
31 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
32 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
33 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
34 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
35 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
36 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
37 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
38 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
39 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
40 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
41 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
42 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
43 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
44 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
45 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
47 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
48 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
51 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
56 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
57 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
58 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
59 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
60 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
61 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
62 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
63 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
64 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
65 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
66 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
67 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
68 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
69 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
70 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
71 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
72 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
73 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
74 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
75 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
76 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466734_004337 3300042623 Bacteria 1442
2 Ga0466702_231333 3300042635 Bacteria 1097
3 Ga0466703_422141 3300042636 Bacteria 8972
4 JGI24702J35022_10127066 3300002462 Bacteria 1412
5 Ga0466718_170333 3300042617 Unclassified 1721
6 Ga0123356_10029869 3300010049 Bacteria 5102
7 Ga0123356_10057579 3300010049 Bacteria 3623
8 Ga0123356_10064196 3300010049 Bacteria 3432
9 Ga0123353_10040660 3300010167 Bacteria 7337
10 Ga0123353_10151337 3300010167 Bacteria 3704
11 Ga0123353_10295964 3300010167 Bacteria 2474
12 Ga0466706_128450 3300042599 Bacteria 8396
13 Ga0466700_101579 3300042600 Bacteria 1418
14 Ga0466700_208134 3300042600 Bacteria 5969
15 Ga0466714_010992 3300042603 Bacteria 2160
16 Ga0466722_184853 3300042609 Bacteria 1312
17 Ga0264413_114208 3300024493 Bacteria 4875
18 Ga0415639_241099 3300038395 Bacteria 1321
19 Ga0466733_021552 3300042659 Bacteria 1202
20 Ga0466733_221668 3300042659 Bacteria 1392
21 Ga0466703_313056 3300042636 Bacteria 2072
22 Ga0466727_275882 3300042655 Bacteria 2525
23 2227499623 2225789004 Bacteria 19539
24 IMNBL1DRAFT_c0000293 3300000062 Bacteria 43031
25 IMNBL1DRAFT_c0008531 3300000062 Bacteria 5204
26 JGI24702J35022_10000233 3300002462 Bacteria 31657
27 Ga0123356_10046623 3300010049 Bacteria 4033
28 Ga0123356_10430836 3300010049 Bacteria 1463
29 Ga0123353_10004882 3300010167 Bacteria 17436
30 Ga0123353_10059990 3300010167 Bacteria 6102
31 Ga0123353_10158401 3300010167 Bacteria 3606
32 Ga0123353_10243207 3300010167 Bacteria 2794
33 Ga0123353_10522808 3300010167 Bacteria 1721
34 Ga0123353_10719733 3300010167 Bacteria 1396
35 Ga0123353_10997956 3300010167 Bacteria 1125
36 Ga0123353_11158173 3300010167 Bacteria 1020
37 Ga0123353_11715533 3300010167 Bacteria 786
38 Ga0466707_277817 3300042601 Bacteria 1056
39 Ga0466707_362351 3300042601 Bacteria 47572
40 Ga0466714_008947 3300042603 Bacteria 1472
41 Ga0466714_091702 3300042603 Bacteria 8148
42 Ga0466717_057671 3300042604 Bacteria 6116
43 Ga0466717_231115 3300042604 Bacteria 1014
44 Ga0466721_140036 3300042608 Bacteria 3594
45 Ga0415639_042061 3300038395 Bacteria 4284
46 Ga0415639_167235 3300038395 Bacteria 3198
47 Ga0466696_099882 3300042596 Bacteria 22150
48 Ga0466732_416751 3300042656 Bacteria 1316
49 Ga0466733_026230 3300042659 Bacteria 1568
50 Ga0466733_116789 3300042659 Bacteria 20760
51 Ga0466702_298804 3300042635 Bacteria 2479
52 Ga0466704_293576 3300042643 Bacteria 26121
53 Ga0466727_007019 3300042655 Bacteria 3263
54 Ga0466718_048978 3300042617 Bacteria 5413
55 Ga0466718_077117 3300042617 Bacteria 2211
56 Ga0466726_308356 3300042619 Bacteria 7627
57 Ga0466729_100664 3300042621 Bacteria 22854
58 Ga0123353_10189966 3300010167 Bacteria 3243
59 Ga0123353_10230785 3300010167 Bacteria 2886
60 Ga0123353_10256091 3300010167 Bacteria 2707
61 Ga0123353_10610013 3300010167 Bacteria 1557
62 Ga0466697_280471 3300042611 Bacteria 3004
63 Ga0466734_167904 3300042623 Bacteria 1915
64 Ga0466735_175481 3300042624 Bacteria 2303
65 Ga0466702_267624 3300042635 Bacteria 1542
66 AustNasuHG_c1004080 3300000089 Bacteria 5252
67 Ga0466723_078800 3300042618 Bacteria 4170
68 Ga0466729_181807 3300042621 Bacteria 68558
69 Ga0123356_10650666 3300010049 Bacteria 1221
70 Ga0123354_10484495 3300010882 Bacteria 976
71 Ga0466706_235811 3300042599 Bacteria 1791
72 Ga0466714_002232 3300042603 Bacteria 2798
73 Ga0415639_002321 3300038395 Bacteria 46097
74 Ga0466692_008011 3300042591 Bacteria 1037
75 Ga0466693_377860 3300042592 Bacteria 2441
76 Ga0466694_261639 3300042594 Bacteria 4288
77 Ga0466705_155034 3300042612 Bacteria 2857
78 IMNBL1DRAFT_c0045642 3300000062 Bacteria 1429
79 AustNasuHG_c1001337 3300000089 Bacteria 8843
80 AustNasuHG_c1007269 3300000089 Bacteria 3942
81 JGI24696J40584_12936520 3300002834 Unclassified 1582
82 Ga0123356_10010811 3300010049 Bacteria 8926
83 Ga0123356_10178922 3300010049 Bacteria 2140
84 Ga0123356_10984333 3300010049 Bacteria 1014
85 Ga0123353_10155312 3300010167 Bacteria 3649
86 Ga0123353_10457439 3300010167 Bacteria 1877
87 Ga0123353_11151745 3300010167 Bacteria 1023
88 Ga0123353_11388307 3300010167 Bacteria 904
89 Ga0466706_198668 3300042599 Bacteria 1906
90 Ga0466706_257089 3300042599 Bacteria 2069
91 Ga0466722_254741 3300042609 Bacteria 13365
92 Ga0466697_014777 3300042611 Bacteria 1095
93 Ga0466733_177187 3300042659 Bacteria 2060
94 Ga0466731_041201 3300042622 Bacteria 1965
95 IMNBL1DRAFT_c0003041 3300000062 Unclassified 11084
96 JGI24697J35500_11274806 3300002507 Bacteria 10026
97 Ga0074263_118508 3300005485 Bacteria 1693
98 Ga0466712_208732 3300042614 Bacteria 1073
99 Ga0466715_144818 3300042616 Bacteria 22479
100 Ga0466715_162149 3300042616 Bacteria 28789
101 Ga0123356_10000458 3300010049 Bacteria 45607
102 Ga0123356_10646516 3300010049 Bacteria 1224
103 Ga0123353_10128460 3300010167 Bacteria 4070
104 Ga0123353_11178361 3300010167 Bacteria 1008
105 Ga0123353_11201539 3300010167 Bacteria 995
106 Ga0123354_10042560 3300010882 Bacteria 6998
107 Ga0123354_10266469 3300010882 Bacteria 1697
108 Ga0123354_10315672 3300010882 Bacteria 1451
109 Ga0466700_331219 3300042600 Bacteria 1884
110 Ga0466714_065900 3300042603 Bacteria 1852
111 Ga0466717_266748 3300042604 Bacteria 2731
112 Ga0466697_149666 3300042611 Bacteria 1817
113 Ga0466705_047142 3300042612 Bacteria 11500
114 Ga0466733_211630 3300042659 Bacteria 1847
115 JGI24697J35500_11122693 3300002507 Bacteria 1238
116 Ga0072941_1069711 3300005201 Bacteria 18634
117 Ga0466715_160206 3300042616 Bacteria 11863
118 Ga0466728_327285 3300042620 Bacteria 6112
119 Ga0123356_10034637 3300010049 Bacteria 4719
120 Ga0123356_10160962 3300010049 Bacteria 2242
121 Ga0123356_10801447 3300010049 Bacteria 1113
122 Ga0123353_10001453 3300010167 Bacteria 28962
123 Ga0123353_10020994 3300010167 Bacteria 9780
124 Ga0123353_10161254 3300010167 Bacteria 3570
125 Ga0123353_10236596 3300010167 Bacteria 2842
126 Ga0123353_10284392 3300010167 Bacteria 2537
127 Ga0123353_10320260 3300010167 Bacteria 2354
128 Ga0123353_10486596 3300010167 Bacteria 1803
129 Ga0466706_025715 3300042599 Bacteria 43777
130 Ga0466706_052594 3300042599 Bacteria 16894
131 Ga0466692_157950 3300042591 Bacteria 17875
132 Ga0466732_043279 3300042656 Bacteria 16924
133 Ga0466733_045884 3300042659 Bacteria 1203
134 Ga0466733_159072 3300042659 Bacteria 4153
135 Ga0466733_207201 3300042659 Unclassified 1332
136 IMNBL1DRAFT_c0000244 3300000062 Bacteria 48034
137 IMNBL1DRAFT_c0015546 3300000062 Bacteria 3300
138 AustNasuHG_c1004317 3300000089 Bacteria 5096
139 JGI24702J35022_10003015 3300002462 Bacteria 10185
140 JGI24702J35022_10005672 3300002462 Bacteria 7280
141 Ga0466705_415609 3300042612 Bacteria 12066
142 Ga0466715_089903 3300042616 Bacteria 14313
143 Ga0466718_075245 3300042617 Bacteria 7495
144 Ga0123356_10062476 3300010049 Bacteria 3479
145 Ga0123356_11007007 3300010049 Bacteria 1003
146 Ga0123353_10094777 3300010167 Bacteria 4809
147 Ga0123353_10126447 3300010167 Unclassified 4108
148 Ga0466713_075955 3300042602 Bacteria 4398
149 Ga0466714_125289 3300042603 Bacteria 1200
150 Ga0466716_489576 3300042605 Bacteria 9551
151 Ga0466719_103342 3300042606 Bacteria 85976

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_170333 Ga0466718_170333_20_604 194
2 3300042594 Ga0466694_261639 Ga0466694_261639_1152_1832 207
3 3300005485 Ga0074263_118508 Ga0074263_1185082 212
4 3300042623 Ga0466734_167904 Ga0466734_167904_348_1028 213
5 3300000062 IMNBL1DRAFT_c0008531 IMNBL1DRAFT_00085315 217
6 3300038395 Ga0415639_167235 Ga0415639_167235_1454_2116 220
7 3300042596 Ga0466696_099882 Ga0466696_099882_16430_17092 220
8 3300042612 Ga0466705_047142 Ga0466705_047142_10234_10896 220
9 3300042618 Ga0466723_078800 Ga0466723_078800_757_1419 220
10 3300042643 Ga0466704_293576 Ga0466704_293576_23291_23953 220
11 3300042612 Ga0466705_155034 Ga0466705_155034_1333_1998 221
12 3300042599 Ga0466706_025715 Ga0466706_025715_24087_24755 222
13 3300042608 Ga0466721_140036 Ga0466721_140036_2901_3569 222
14 3300042609 Ga0466722_184853 Ga0466722_184853_546_1214 222
15 3300042609 Ga0466722_254741 Ga0466722_254741_12279_12947 222
16 3300042621 Ga0466729_100664 Ga0466729_100664_9565_10233 222
17 3300042655 Ga0466727_007019 Ga0466727_007019_916_1584 222
18 iso_pr_bacteria 2820414148 2820416210 222
19 iso_pr_bacteria 2820414148 2820416318 222
20 3300010167 Ga0123353_10126447 Ga0123353_101264473 223
21 3300010167 Ga0123353_10151337 Ga0123353_101513372 223
22 3300010167 Ga0123353_11201539 Ga0123353_112015391 223
23 3300024493 Ga0264413_114208 Ga0264413_1142084 223
24 3300042616 Ga0466715_089903 Ga0466715_089903_1561_2232 223
25 3300042616 Ga0466715_162149 Ga0466715_162149_23589_24260 223
26 3300042621 Ga0466729_181807 Ga0466729_181807_59625_60296 223
27 3300042624 Ga0466735_175481 Ga0466735_175481_1111_1782 223
28 iso_pr_bacteria 2788499854 2788758986 223
29 iso_pr_bacteria 2940352027 2940353068 223
30 iso_pr_bacteria 2940354458 2940355586 223
31 iso_pr_bacteria 2940356891 2940357964 223
32 iso_pr_bacteria 2940359323 2940360452 223
33 iso_pr_bacteria 2940361758 2940362799 223
34 iso_pr_bacteria 2940364193 2940365353 223
35 iso_pr_bacteria 2940366561 2940367672 223
36 iso_pr_bacteria 2940368928 2940369895 223
37 3300010167 Ga0123353_10001453 Ga0123353_1000145312 224
38 3300010167 Ga0123353_10243207 Ga0123353_102432073 224
39 3300042659 Ga0466733_211630 Ga0466733_211630_1044_1718 224
40 iso_pr_bacteria 2820261600 2820262568 224
41 iso_pr_bacteria 2820344559 2820346700 224
42 3300002462 JGI24702J35022_10127066 JGI24702J35022_101270662 225
43 3300010049 Ga0123356_10057579 Ga0123356_100575792 225
44 3300038395 Ga0415639_241099 Ga0415639_241099_43_720 225
45 3300042592 Ga0466693_377860 Ga0466693_377860_1370_2047 225
46 3300042601 Ga0466707_277817 Ga0466707_277817_334_1011 225
47 3300042603 Ga0466714_002232 Ga0466714_002232_834_1511 225
48 3300042603 Ga0466714_065900 Ga0466714_065900_1158_1835 225
49 3300042617 Ga0466718_048978 Ga0466718_048978_3971_4648 225
50 3300042622 Ga0466731_041201 Ga0466731_041201_24_701 225
51 3300042655 Ga0466727_275882 Ga0466727_275882_947_1624 225
52 3300042656 Ga0466732_043279 Ga0466732_043279_1956_2633 225
53 3300042656 Ga0466732_416751 Ga0466732_416751_87_764 225
54 iso_pr_bacteria 2529293168 2531453611 225
55 iso_pr_bacteria 2820246658 2820247653 225
56 iso_pr_bacteria 2820442516 2820444639 225
57 3300000089 AustNasuHG_c1001337 AustNasuHG_10013375 226
58 3300010049 Ga0123356_10000458 Ga0123356_100004585 226
59 3300010049 Ga0123356_10029869 Ga0123356_100298692 226
60 3300010049 Ga0123356_10034637 Ga0123356_100346372 226
61 3300010049 Ga0123356_10046623 Ga0123356_100466233 226
62 3300010049 Ga0123356_10064196 Ga0123356_100641964 226
63 3300010049 Ga0123356_10160962 Ga0123356_101609622 226
64 3300010049 Ga0123356_10650666 Ga0123356_106506661 226
65 3300010049 Ga0123356_10984333 Ga0123356_109843331 226
66 3300010167 Ga0123353_10004882 Ga0123353_100048824 226
67 3300010167 Ga0123353_10020994 Ga0123353_100209943 226
68 3300010167 Ga0123353_10040660 Ga0123353_100406605 226
69 3300010167 Ga0123353_10128460 Ga0123353_101284602 226
70 3300010167 Ga0123353_10158401 Ga0123353_101584012 226
71 3300010167 Ga0123353_10161254 Ga0123353_101612543 226
72 3300010167 Ga0123353_10189966 Ga0123353_101899663 226
73 3300010167 Ga0123353_10230785 Ga0123353_102307852 226
74 3300010167 Ga0123353_10320260 Ga0123353_103202602 226
75 3300010167 Ga0123353_10486596 Ga0123353_104865962 226
76 3300010167 Ga0123353_10522808 Ga0123353_105228082 226
77 3300010167 Ga0123353_10997956 Ga0123353_109979562 226
78 3300010167 Ga0123353_11388307 Ga0123353_113883071 226
79 3300010882 Ga0123354_10266469 Ga0123354_102664692 226
80 3300010882 Ga0123354_10315672 Ga0123354_103156722 226
81 3300042591 Ga0466692_157950 Ga0466692_157950_4267_4947 226
82 3300042600 Ga0466700_331219 Ga0466700_331219_296_976 226
83 3300042601 Ga0466707_362351 Ga0466707_362351_45912_46592 226
84 3300042603 Ga0466714_008947 Ga0466714_008947_633_1313 226
85 3300042612 Ga0466705_415609 Ga0466705_415609_6280_6960 226
86 3300042616 Ga0466715_160206 Ga0466715_160206_8636_9316 226
87 3300042636 Ga0466703_313056 Ga0466703_313056_647_1327 226
88 3300042659 Ga0466733_021552 Ga0466733_021552_47_727 226
89 3300042659 Ga0466733_177187 Ga0466733_177187_706_1386 226
90 3300042659 Ga0466733_207201 Ga0466733_207201_620_1300 226
91 iso_pr_bacteria 2820272499 2820274499 226
92 iso_pr_bacteria 2820420508 2820421947 226
93 3300000062 IMNBL1DRAFT_c0015546 IMNBL1DRAFT_00155462 227
94 3300000062 IMNBL1DRAFT_c0045642 IMNBL1DRAFT_00456422 227
95 3300000089 AustNasuHG_c1004317 AustNasuHG_10043173 227
96 3300010049 Ga0123356_10178922 Ga0123356_101789222 227
97 3300010167 Ga0123353_10059990 Ga0123353_100599902 227
98 3300010167 Ga0123353_10094777 Ga0123353_100947775 227
99 3300042591 Ga0466692_008011 Ga0466692_008011_96_779 227
100 3300042599 Ga0466706_128450 Ga0466706_128450_3123_3806 227
101 3300042599 Ga0466706_198668 Ga0466706_198668_493_1176 227
102 3300042599 Ga0466706_235811 Ga0466706_235811_216_899 227
103 3300042600 Ga0466700_208134 Ga0466700_208134_3721_4404 227
104 3300042605 Ga0466716_489576 Ga0466716_489576_1038_1721 227
105 3300042619 Ga0466726_308356 Ga0466726_308356_4299_4982 227
106 3300042620 Ga0466728_327285 Ga0466728_327285_4557_5240 227
107 3300042636 Ga0466703_422141 Ga0466703_422141_6308_6991 227
108 iso_pr_bacteria 2820229114 2820229231 227
109 iso_pr_bacteria 2820321184 2820321622 227
110 2225789004 2227499623 2227980744 228
111 3300000062 IMNBL1DRAFT_c0003041 IMNBL1DRAFT_00030417 228
112 3300000089 AustNasuHG_c1004080 AustNasuHG_10040803 228
113 3300002462 JGI24702J35022_10003015 JGI24702J35022_100030154 228
114 3300010049 Ga0123356_10646516 Ga0123356_106465162 228
115 3300010167 Ga0123353_11715533 Ga0123353_117155332 228
116 3300038395 Ga0415639_002321 Ga0415639_002321_587_1273 228
117 3300038395 Ga0415639_042061 Ga0415639_042061_1017_1703 228
118 3300042602 Ga0466713_075955 Ga0466713_075955_311_997 228
119 3300042603 Ga0466714_125289 Ga0466714_125289_235_921 228
120 3300042604 Ga0466717_057671 Ga0466717_057671_1513_2199 228
121 3300042604 Ga0466717_231115 Ga0466717_231115_150_1001 228
122 3300042606 Ga0466719_103342 Ga0466719_103342_51327_52013 228
123 3300042611 Ga0466697_149666 Ga0466697_149666_839_1525 228
124 3300042611 Ga0466697_280471 Ga0466697_280471_2192_2878 228
125 3300042614 Ga0466712_208732 Ga0466712_208732_199_885 228
126 3300042616 Ga0466715_144818 Ga0466715_144818_3291_3977 228
127 3300042617 Ga0466718_077117 Ga0466718_077117_1172_1858 228
128 3300042659 Ga0466733_026230 Ga0466733_026230_535_1221 228
129 3300042659 Ga0466733_045884 Ga0466733_045884_148_834 228
130 3300042659 Ga0466733_116789 Ga0466733_116789_18230_18916 228
131 3300042659 Ga0466733_221668 Ga0466733_221668_425_1111 228
132 iso_pr_bacteria 2820220859 2820221747 228
133 iso_pr_bacteria 2820255904 2820257309 228
134 iso_pr_bacteria 2820336130 2820338227 228
135 iso_pr_bacteria 8030337018 8030339036 228
136 3300002462 JGI24702J35022_10000233 JGI24702J35022_100002339 229
137 3300002462 JGI24702J35022_10005672 JGI24702J35022_100056722 229
138 3300010049 Ga0123356_10010811 Ga0123356_100108117 229
139 3300010049 Ga0123356_10062476 Ga0123356_100624763 229
140 3300042600 Ga0466700_101579 Ga0466700_101579_690_1379 229
141 3300042635 Ga0466702_298804 Ga0466702_298804_800_1489 229
142 3300042659 Ga0466733_159072 Ga0466733_159072_1704_2393 229
143 iso_pr_bacteria 2590828841 2593260099 229
144 iso_pr_bacteria 2940236825 2940238301 229
145 iso_pr_bacteria 2940339133 2940340661 229
146 iso_pr_bacteria 2940341480 2940342243 229
147 iso_pr_bacteria 2940343849 2940344603 229
148 3300000089 AustNasuHG_c1007269 AustNasuHG_10072693 230
149 3300010049 Ga0123356_10801447 Ga0123356_108014471 230
150 3300010167 Ga0123353_10295964 Ga0123353_102959642 230
151 3300010167 Ga0123353_10610013 Ga0123353_106100132 230
152 3300010167 Ga0123353_10719733 Ga0123353_107197332 230
153 3300010167 Ga0123353_11158173 Ga0123353_111581732 230
154 3300010882 Ga0123354_10484495 Ga0123354_104844952 230
155 3300042603 Ga0466714_091702 Ga0466714_091702_3676_4368 230
156 3300000062 IMNBL1DRAFT_c0000293 IMNBL1DRAFT_000029329 231
157 3300005201 Ga0072941_1069711 Ga0072941_106971113 231
158 3300010167 Ga0123353_10155312 Ga0123353_101553124 231
159 3300010167 Ga0123353_10284392 Ga0123353_102843922 231
160 3300042599 Ga0466706_052594 Ga0466706_052594_3201_3896 231
161 3300002507 JGI24697J35500_11122693 JGI24697J35500_111226931 232
162 3300002507 JGI24697J35500_11274806 JGI24697J35500_112748066 232
163 3300010049 Ga0123356_10430836 Ga0123356_104308362 232
164 3300010882 Ga0123354_10042560 Ga0123354_100425602 232
165 3300042617 Ga0466718_075245 Ga0466718_075245_4298_4996 232
166 iso_pr_bacteria 2820373881 2820375370 232
167 3300002834 JGI24696J40584_12936520 JGI24696J40584_129365202 233
168 3300042604 Ga0466717_266748 Ga0466717_266748_340_1041 233
169 3300042623 Ga0466734_004337 Ga0466734_004337_107_808 233
170 3300042635 Ga0466702_231333 Ga0466702_231333_27_728 233
171 iso_pr_bacteria 2820265624 2820265922 233
172 iso_pr_bacteria 2820393573 2820395624 233
173 3300042611 Ga0466697_014777 Ga0466697_014777_182_886 234
174 3300010049 Ga0123356_11007007 Ga0123356_110070071 235
175 3300042603 Ga0466714_010992 Ga0466714_010992_1434_2141 235
176 3300010167 Ga0123353_10236596 Ga0123353_102365962 236
177 3300042635 Ga0466702_267624 Ga0466702_267624_627_1340 237
178 3300010167 Ga0123353_10457439 Ga0123353_104574392 240
179 3300010167 Ga0123353_11178361 Ga0123353_111783612 244
180 3300010167 Ga0123353_10256091 Ga0123353_102560912 245
181 3300010167 Ga0123353_11151745 Ga0123353_111517451 250
182 3300000062 IMNBL1DRAFT_c0000244 IMNBL1DRAFT_000024436 251
183 3300042599 Ga0466706_257089 Ga0466706_257089_327_1121 264

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00072 Response_reg Response regulator receiver domain 42 149 0.98
PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal 189 262 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00072 GO:0000160 phosphorelay signal transduction system BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.54 0.61 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.