Protein Family IF05689
Metagenome
Metatranscriptome
Isolate
123
Members
72
Samples
97
Scaffolds
96.35
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_252153|Ga0466706_252153_12_335
- Length
- 107 aa
- Sequence
- MLIRHFYGNEIMMVLVSYDVCVSDATGAKRLRHVAKACQDFGQRVQYSVFEIEVDFAQWTALKKRLIDSIDPEKDSLRFYYLGNNWQRRVEHVGAKATVNLNGALVF
Sample Types
Isolate
21.1%
Metagenome
78.0%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.9%
Kalotermitidae
13.9%
Apidae
12.5%
Unclassified
9.7%
Blattidae
6.9%
Coreidae
5.6%
Rhinotermitidae
4.2%
Formicidae
4.2%
Termopsidae
2.8%
Passalidae
2.8%
Daphniidae
1.4%
Hodotermitidae
1.4%
Noctuidae
1.4%
Drosophilidae
1.4%
Taxonomy
Archaea
0
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 12 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 13 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 14 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 15 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 27 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 28 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 35 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 36 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 37 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 40 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 43 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 44 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 45 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 46 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 52 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 53 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 54 | 2820053807 | Unclassified Proteobacteria Th196P3bin117 | Isolate | Unclassified |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 57 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 58 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 59 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 60 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 61 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 62 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 63 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 64 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 65 | 2820215626 | Unclassified Kiritimatiellaeota Nt197P3bin123 | Isolate | Unclassified |
| 66 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 67 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 68 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 69 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 70 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 71 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 72 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_215474 | 3300042611 | Bacteria | 1054 |
| 2 | Ga0466696_325817 | 3300042596 | Bacteria | 2368 |
| 3 | Ga0466725_190557 | 3300042654 | Bacteria | 1980 |
| 4 | Ga0466707_189592 | 3300042601 | Bacteria | 1088 |
| 5 | Ga0123356_11761086 | 3300010049 | Bacteria | 769 |
| 6 | Ga0123353_10820038 | 3300010167 | Bacteria | 1281 |
| 7 | JGI24702J35022_10184201 | 3300002462 | Bacteria | 1188 |
| 8 | Ga0466705_007845 | 3300042612 | Unclassified | 2936 |
| 9 | Ga0466705_384137 | 3300042612 | Bacteria | 2145 |
| 10 | Ga0466723_356937 | 3300042618 | Bacteria | 6895 |
| 11 | Ga0466729_019751 | 3300042621 | Bacteria | 1471 |
| 12 | Ga0466694_357412 | 3300042594 | Bacteria | 1634 |
| 13 | Ga0466729_204495 | 3300042621 | Bacteria | 1868 |
| 14 | Ga0466731_181615 | 3300042622 | Bacteria | 5017 |
| 15 | Ga0466719_410131 | 3300042606 | Bacteria | 2143 |
| 16 | Ga0123355_10604419 | 3300009826 | Bacteria | 1300 |
| 17 | Ga0123353_10503036 | 3300010167 | Bacteria | 1765 |
| 18 | Ga0123354_10171421 | 3300010882 | Bacteria | 2523 |
| 19 | JGI24705J35276_12237668 | 3300002504 | Bacteria | 12417 |
| 20 | Ga0068302_10054488 | 3300005071 | Bacteria | 3327 |
| 21 | Ga0466697_177496 | 3300042611 | Bacteria | 2623 |
| 22 | Ga0466711_236548 | 3300042615 | Bacteria | 1316 |
| 23 | Ga0466723_008327 | 3300042618 | Bacteria | 1577 |
| 24 | Ga0466726_075844 | 3300042619 | Bacteria | 3257 |
| 25 | Ga0466703_024223 | 3300042636 | Bacteria | 46401 |
| 26 | Ga0466704_325804 | 3300042643 | Bacteria | 10934 |
| 27 | Ga0466725_232977 | 3300042654 | Unclassified | 1006 |
| 28 | Ga0466725_295227 | 3300042654 | Bacteria | 2093 |
| 29 | Ga0466707_235094 | 3300042601 | Unclassified | 6137 |
| 30 | Ga0466717_222133 | 3300042604 | Bacteria | 1213 |
| 31 | Ga0123357_10026727 | 3300009784 | Unclassified | 7794 |
| 32 | Ga0123356_10579345 | 3300010049 | Unclassified | 1285 |
| 33 | Ga0123353_10001736 | 3300010167 | Bacteria | 26759 |
| 34 | Ga0123353_10002280 | 3300010167 | Bacteria | 23807 |
| 35 | Ga0123354_10012830 | 3300010882 | Unclassified | 12981 |
| 36 | CVPL005L_10006561 | 3300002938 | Unclassified | 11452 |
| 37 | Ga0466711_307281 | 3300042615 | Bacteria | 12437 |
| 38 | Ga0466703_002210 | 3300042636 | Bacteria | 7631 |
| 39 | Ga0466706_252153 | 3300042599 | Bacteria | 2061 |
| 40 | Ga0466706_262034 | 3300042599 | Bacteria | 1248 |
| 41 | Ga0123356_11635489 | 3300010049 | Bacteria | 798 |
| 42 | JGI24702J35022_10101652 | 3300002462 | Unclassified | 1574 |
| 43 | Ga0466710_040614 | 3300042613 | Bacteria | 1159 |
| 44 | Ga0466726_224736 | 3300042619 | Unclassified | 3306 |
| 45 | Ga0255809_1024771 | 3300022820 | Bacteria | 854 |
| 46 | Ga0466656_110641 | 3300042550 | Bacteria | 3380 |
| 47 | Ga0466692_014006 | 3300042591 | Bacteria | 1258 |
| 48 | Ga0466693_040014 | 3300042592 | Bacteria | 7746 |
| 49 | Ga0466725_212912 | 3300042654 | Bacteria | 1251 |
| 50 | Ga0466707_052747 | 3300042601 | Bacteria | 1426 |
| 51 | Ga0466721_011934 | 3300042608 | Unclassified | 13505 |
| 52 | Ga0123357_10593696 | 3300009784 | Bacteria | 855 |
| 53 | Ga0123353_10510042 | 3300010167 | Bacteria | 1749 |
| 54 | Ga0123354_10890864 | 3300010882 | Unclassified | 585 |
| 55 | JGI24696J40584_12597831 | 3300002834 | Bacteria | 655 |
| 56 | Ga0466697_104259 | 3300042611 | Bacteria | 1068 |
| 57 | Ga0466710_248584 | 3300042613 | Bacteria | 3623 |
| 58 | Ga0466718_126138 | 3300042617 | Bacteria | 1129 |
| 59 | Ga0466729_192319 | 3300042621 | Bacteria | 1608 |
| 60 | Ga0466731_302102 | 3300042622 | Bacteria | 8316 |
| 61 | Ga0466708_088006 | 3300042652 | Bacteria | 1290 |
| 62 | Ga0466701_053281 | 3300042598 | Bacteria | 1077 |
| 63 | Ga0466707_022491 | 3300042601 | Bacteria | 1293 |
| 64 | Ga0466707_269706 | 3300042601 | Bacteria | 1037 |
| 65 | Ga0466722_129920 | 3300042609 | Bacteria | 6247 |
| 66 | Ga0123355_10581339 | 3300009826 | Bacteria | 1339 |
| 67 | Ga0123356_10000584 | 3300010049 | Bacteria | 40505 |
| 68 | Ga0123353_10001710 | 3300010167 | Bacteria | 26959 |
| 69 | 2227509511 | 2225789004 | Bacteria | 706 |
| 70 | 2227591284 | 2225789004 | Bacteria | 48103 |
| 71 | JGI24705J35276_11640584 | 3300002504 | Bacteria | 607 |
| 72 | Ga0104044_1160237 | 3300007136 | Bacteria | 661 |
| 73 | Ga0466733_215555 | 3300042659 | Bacteria | 1254 |
| 74 | Ga0466711_019397 | 3300042615 | Unclassified | 1023 |
| 75 | Ga0466657_059011 | 3300042582 | Bacteria | 1109 |
| 76 | Ga0466692_203724 | 3300042591 | Bacteria | 1085 |
| 77 | Ga0466699_277884 | 3300042597 | Bacteria | 1680 |
| 78 | Ga0466729_291361 | 3300042621 | Unclassified | 1721 |
| 79 | Ga0466707_348524 | 3300042601 | Bacteria | 1212 |
| 80 | Ga0466716_063650 | 3300042605 | Bacteria | 1755 |
| 81 | Ga0123355_10192766 | 3300009826 | Bacteria | 2997 |
| 82 | Ga0123355_11235571 | 3300009826 | Bacteria | 758 |
| 83 | Ga0123356_11322491 | 3300010049 | Bacteria | 883 |
| 84 | Ga0123356_12520154 | 3300010049 | Bacteria | 644 |
| 85 | 2227565280 | 2225789004 | Bacteria | 548 |
| 86 | CVPL010L_1000001 | 3300002932 | Bacteria | 547858 |
| 87 | Ga0466715_157211 | 3300042616 | Bacteria | 1021 |
| 88 | Ga0466696_006505 | 3300042596 | Unclassified | 5433 |
| 89 | Ga0466706_270450 | 3300042599 | Bacteria | 4586 |
| 90 | Ga0466713_079434 | 3300042602 | Bacteria | 4530 |
| 91 | Ga0466722_049414 | 3300042609 | Bacteria | 3259 |
| 92 | Ga0466722_153240 | 3300042609 | Bacteria | 4967 |
| 93 | 2227527893 | 2225789004 | Bacteria | 641 |
| 94 | IMNBL1DRAFT_c0000717 | 3300000062 | Bacteria | 26446 |
| 95 | IMNBL1DRAFT_c0001959 | 3300000062 | Bacteria | 14829 |
| 96 | IMNBL1DRAFT_c0009291 | 3300000062 | Bacteria | 4872 |
| 97 | JGI24702J35022_10026887 | 3300002462 | Bacteria | 3096 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042609 | Ga0466722_153240 | Ga0466722_153240_964_1230 | 88 |
| 2 | 3300042601 | Ga0466707_052747 | Ga0466707_052747_182_460 | 92 |
| 3 | 3300009784 | Ga0123357_10593696 | Ga0123357_105936961 | 95 |
| 4 | 3300009826 | Ga0123355_10604419 | Ga0123355_106044191 | 95 |
| 5 | 3300042611 | Ga0466697_104259 | Ga0466697_104259_742_1029 | 95 |
| 6 | 2225789004 | 2227509511 | 2228002280 | 96 |
| 7 | 2225789004 | 2227565280 | 2228106319 | 96 |
| 8 | 2225789004 | 2227591284 | 2228150673 | 96 |
| 9 | 3300009826 | Ga0123355_10192766 | Ga0123355_101927662 | 96 |
| 10 | 3300022820 | Ga0255809_1024771 | Ga0255809_10247712 | 96 |
| 11 | 3300042550 | Ga0466656_110641 | Ga0466656_110641_218_508 | 96 |
| 12 | 3300042582 | Ga0466657_059011 | Ga0466657_059011_389_679 | 96 |
| 13 | 3300042591 | Ga0466692_014006 | Ga0466692_014006_232_522 | 96 |
| 14 | 3300042591 | Ga0466692_203724 | Ga0466692_203724_717_1007 | 96 |
| 15 | 3300042592 | Ga0466693_040014 | Ga0466693_040014_6632_6922 | 96 |
| 16 | 3300042594 | Ga0466694_357412 | Ga0466694_357412_945_1235 | 96 |
| 17 | 3300042596 | Ga0466696_006505 | Ga0466696_006505_369_659 | 96 |
| 18 | 3300042596 | Ga0466696_325817 | Ga0466696_325817_1590_1880 | 96 |
| 19 | 3300042597 | Ga0466699_277884 | Ga0466699_277884_170_460 | 96 |
| 20 | 3300042598 | Ga0466701_053281 | Ga0466701_053281_565_855 | 96 |
| 21 | 3300042599 | Ga0466706_262034 | Ga0466706_262034_142_432 | 96 |
| 22 | 3300042599 | Ga0466706_270450 | Ga0466706_270450_3591_3881 | 96 |
| 23 | 3300042601 | Ga0466707_022491 | Ga0466707_022491_556_846 | 96 |
| 24 | 3300042601 | Ga0466707_189592 | Ga0466707_189592_452_742 | 96 |
| 25 | 3300042601 | Ga0466707_235094 | Ga0466707_235094_46_336 | 96 |
| 26 | 3300042601 | Ga0466707_269706 | Ga0466707_269706_473_763 | 96 |
| 27 | 3300042601 | Ga0466707_348524 | Ga0466707_348524_585_875 | 96 |
| 28 | 3300042602 | Ga0466713_079434 | Ga0466713_079434_3881_4171 | 96 |
| 29 | 3300042604 | Ga0466717_222133 | Ga0466717_222133_507_797 | 96 |
| 30 | 3300042605 | Ga0466716_063650 | Ga0466716_063650_758_1048 | 96 |
| 31 | 3300042606 | Ga0466719_410131 | Ga0466719_410131_1428_1718 | 96 |
| 32 | 3300042608 | Ga0466721_011934 | Ga0466721_011934_2369_2659 | 96 |
| 33 | 3300042609 | Ga0466722_049414 | Ga0466722_049414_2174_2464 | 96 |
| 34 | 3300042609 | Ga0466722_129920 | Ga0466722_129920_237_527 | 96 |
| 35 | 3300042612 | Ga0466705_007845 | Ga0466705_007845_1081_1371 | 96 |
| 36 | 3300042612 | Ga0466705_384137 | Ga0466705_384137_1393_1683 | 96 |
| 37 | 3300042613 | Ga0466710_040614 | Ga0466710_040614_658_948 | 96 |
| 38 | 3300042613 | Ga0466710_248584 | Ga0466710_248584_1493_1783 | 96 |
| 39 | 3300042615 | Ga0466711_019397 | Ga0466711_019397_378_668 | 96 |
| 40 | 3300042615 | Ga0466711_236548 | Ga0466711_236548_428_718 | 96 |
| 41 | 3300042615 | Ga0466711_307281 | Ga0466711_307281_11059_11349 | 96 |
| 42 | 3300042616 | Ga0466715_157211 | Ga0466715_157211_503_793 | 96 |
| 43 | 3300042617 | Ga0466718_126138 | Ga0466718_126138_131_421 | 96 |
| 44 | 3300042618 | Ga0466723_008327 | Ga0466723_008327_137_427 | 96 |
| 45 | 3300042618 | Ga0466723_356937 | Ga0466723_356937_1833_2123 | 96 |
| 46 | 3300042619 | Ga0466726_075844 | Ga0466726_075844_2628_2918 | 96 |
| 47 | 3300042619 | Ga0466726_224736 | Ga0466726_224736_2662_2952 | 96 |
| 48 | 3300042621 | Ga0466729_019751 | Ga0466729_019751_877_1167 | 96 |
| 49 | 3300042621 | Ga0466729_192319 | Ga0466729_192319_287_577 | 96 |
| 50 | 3300042621 | Ga0466729_204495 | Ga0466729_204495_223_513 | 96 |
| 51 | 3300042621 | Ga0466729_291361 | Ga0466729_291361_1002_1292 | 96 |
| 52 | 3300042622 | Ga0466731_181615 | Ga0466731_181615_348_638 | 96 |
| 53 | 3300042622 | Ga0466731_302102 | Ga0466731_302102_280_570 | 96 |
| 54 | 3300042636 | Ga0466703_002210 | Ga0466703_002210_6779_7069 | 96 |
| 55 | 3300042636 | Ga0466703_024223 | Ga0466703_024223_1536_1826 | 96 |
| 56 | 3300042643 | Ga0466704_325804 | Ga0466704_325804_429_719 | 96 |
| 57 | 3300042652 | Ga0466708_088006 | Ga0466708_088006_715_1005 | 96 |
| 58 | 3300042654 | Ga0466725_190557 | Ga0466725_190557_666_956 | 96 |
| 59 | 3300042654 | Ga0466725_212912 | Ga0466725_212912_878_1168 | 96 |
| 60 | 3300042654 | Ga0466725_232977 | Ga0466725_232977_39_329 | 96 |
| 61 | 3300042654 | Ga0466725_295227 | Ga0466725_295227_217_507 | 96 |
| 62 | 3300042659 | Ga0466733_215555 | Ga0466733_215555_549_839 | 96 |
| 63 | iso_pr_bacteria | 2551306396 | 2552923640 | 96 |
| 64 | iso_pr_bacteria | 2556921669 | 2558282382 | 96 |
| 65 | iso_pr_bacteria | 2595698190 | 2596206495 | 96 |
| 66 | iso_pr_bacteria | 2595698193 | 2596211907 | 96 |
| 67 | iso_pr_bacteria | 2595698194 | 2596212357 | 96 |
| 68 | iso_pr_bacteria | 2595698195 | 2596215583 | 96 |
| 69 | iso_pr_bacteria | 2595698196 | 2596217410 | 96 |
| 70 | iso_pr_bacteria | 2595698197 | 2596219246 | 96 |
| 71 | iso_pr_bacteria | 2595698198 | 2596221078 | 96 |
| 72 | iso_pr_bacteria | 2595698199 | 2596222883 | 96 |
| 73 | iso_pr_bacteria | 2627853628 | 2628281291 | 96 |
| 74 | iso_pr_bacteria | 2681813507 | 2684383171 | 96 |
| 75 | iso_pr_bacteria | 2820053807 | 2820053957 | 96 |
| 76 | iso_pr_bacteria | 2820215626 | 2820215668 | 96 |
| 77 | iso_pr_bacteria | 2886876212 | 2886876683 | 96 |
| 78 | iso_pr_bacteria | 2940228231 | 2940230084 | 96 |
| 79 | iso_pr_bacteria | 2940264388 | 2940266146 | 96 |
| 80 | iso_pr_bacteria | 2940267548 | 2940269240 | 96 |
| 81 | iso_pr_bacteria | 2940270707 | 2940272399 | 96 |
| 82 | iso_pr_bacteria | 2940273867 | 2940275630 | 96 |
| 83 | iso_pr_bacteria | 2983866074 | 2983868781 | 96 |
| 84 | iso_pr_bacteria | 650716050 | 650845894 | 96 |
| 85 | iso_pr_bacteria | 8025701579 | 8025705865 | 96 |
| 86 | iso_pr_bacteria | 8025728939 | 8025729030 | 96 |
| 87 | iso_pr_bacteria | 8102174626 | 8102174717 | 96 |
| 88 | iso_pr_bacteria | 8102201977 | 8102206263 | 96 |
| 89 | 3300000062 | IMNBL1DRAFT_c0000717 | IMNBL1DRAFT_000071715 | 97 |
| 90 | 3300000062 | IMNBL1DRAFT_c0001959 | IMNBL1DRAFT_000195912 | 97 |
| 91 | 3300000062 | IMNBL1DRAFT_c0009291 | IMNBL1DRAFT_00092915 | 97 |
| 92 | 3300002462 | JGI24702J35022_10026887 | JGI24702J35022_100268871 | 97 |
| 93 | 3300002462 | JGI24702J35022_10101652 | JGI24702J35022_101016522 | 97 |
| 94 | 3300002462 | JGI24702J35022_10184201 | JGI24702J35022_101842011 | 97 |
| 95 | 3300002504 | JGI24705J35276_11640584 | JGI24705J35276_116405841 | 97 |
| 96 | 3300002504 | JGI24705J35276_12237668 | JGI24705J35276_1223766811 | 97 |
| 97 | 3300002834 | JGI24696J40584_12597831 | JGI24696J40584_125978312 | 97 |
| 98 | 3300002932 | CVPL010L_1000001 | CVPL010L_1000001359 | 97 |
| 99 | 3300002938 | CVPL005L_10006561 | CVPL005L_100065612 | 97 |
| 100 | 3300005071 | Ga0068302_10054488 | Ga0068302_100544881 | 97 |
| 101 | 3300009784 | Ga0123357_10026727 | Ga0123357_100267273 | 97 |
| 102 | 3300009826 | Ga0123355_10581339 | Ga0123355_105813391 | 97 |
| 103 | 3300010049 | Ga0123356_10579345 | Ga0123356_105793452 | 97 |
| 104 | 3300010049 | Ga0123356_11322491 | Ga0123356_113224911 | 97 |
| 105 | 3300010049 | Ga0123356_11635489 | Ga0123356_116354891 | 97 |
| 106 | 3300010049 | Ga0123356_11761086 | Ga0123356_117610862 | 97 |
| 107 | 3300010049 | Ga0123356_12520154 | Ga0123356_125201541 | 97 |
| 108 | 3300010167 | Ga0123353_10001710 | Ga0123353_1000171011 | 97 |
| 109 | 3300010167 | Ga0123353_10001736 | Ga0123353_1000173612 | 97 |
| 110 | 3300010167 | Ga0123353_10002280 | Ga0123353_100022809 | 97 |
| 111 | 3300010167 | Ga0123353_10503036 | Ga0123353_105030363 | 97 |
| 112 | 3300010167 | Ga0123353_10510042 | Ga0123353_105100422 | 97 |
| 113 | 3300010167 | Ga0123353_10820038 | Ga0123353_108200381 | 97 |
| 114 | 3300010882 | Ga0123354_10012830 | Ga0123354_100128304 | 97 |
| 115 | 3300010882 | Ga0123354_10171421 | Ga0123354_101714211 | 97 |
| 116 | 3300010882 | Ga0123354_10890864 | Ga0123354_108908642 | 97 |
| 117 | 3300042611 | Ga0466697_215474 | Ga0466697_215474_206_499 | 97 |
| 118 | 3300007136 | Ga0104044_1160237 | Ga0104044_11602372 | 98 |
| 119 | 3300009826 | Ga0123355_11235571 | Ga0123355_112355712 | 98 |
| 120 | 2225789004 | 2227527893 | 2228037461 | 99 |
| 121 | 3300010049 | Ga0123356_10000584 | Ga0123356_100005845 | 101 |
| 122 | 3300042611 | Ga0466697_177496 | Ga0466697_177496_1992_2300 | 102 |
| 123 | 3300042599 | Ga0466706_252153 | Ga0466706_252153_12_335 | 107 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09827 | CRISPR_Cas2 | CRISPR associated protein Cas2 | 12 | 89 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.7 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.