Protein Family IF05678

Metagenome Isolate
173 Members
70 Samples
147 Scaffolds
251.42 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_229372|Ga0466706_229372_248_1090
Length
280 aa
Sequence
MKRWDKLSILGLIIGIGAILGGQMLEGGHASSLWQPAALMIVLGGTTGAVLLQSPFVLFRRGIALLSWVFRPPVISLPRDIQLLLRFALIARREGFLALEHAIPADADPFVQRGLQLLVDGIEPAKLRDVLEAELTTFEDELRHAAKIWDSAGGYSPTIGILGAVLGLIHVMDNLADPAKLGLGIATAFVATVYGVGLANLVYIPIANKLKTLIAAQVARREMLIDGIAAIAVGENPRIIESRLTGYLPQKMSNQKAAHRAESRSTTPATSSPDSPQKID

📊 Sample Types

Isolate 15.0%
Metagenome 85.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 29.9%
Termitidae 26.9%
Kalotermitidae 20.9%
Elmidae 9.0%
Rhinotermitidae 4.5%
Termopsidae 4.5%
Lysianassidae 1.5%
Hodotermitidae 1.5%
Passalidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 166
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
2 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
3 2864755708 Massilia timonae S00006 Isolate Elmidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
13 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
14 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
27 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
28 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
29 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
32 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
40 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
41 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 2585427605 Colwellia sp. MT2012 Isolate
44 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
45 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
46 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
47 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
48 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
51 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
52 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
53 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
54 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
55 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
56 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
57 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
58 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
59 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
60 2585428048 Colwellia sp. NBT2012 Isolate
61 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
62 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
63 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
64 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
65 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
66 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
67 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
68 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
69 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
70 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_065264 3300042611 Bacteria 2242
2 Ga0466705_022003 3300042612 Bacteria 8799
3 Ga0466705_257618 3300042612 Bacteria 1643
4 Ga0466734_142851 3300042623 Bacteria 3568
5 Ga0466703_181666 3300042636 Bacteria 1463
6 Ga0466703_292925 3300042636 Bacteria 11341
7 Ga0466725_018948 3300042654 Bacteria 15224
8 Ga0466715_369080 3300042616 Bacteria 23402
9 Ga0466726_278257 3300042619 Bacteria 13445
10 Ga0466657_054897 3300042582 Bacteria 3748
11 Ga0466690_066435 3300042590 Bacteria 7687
12 Ga0466692_157774 3300042591 Bacteria 50952
13 JGI24705J35276_12237100 3300002504 Bacteria 9812
14 Ga0072941_1199762 3300005201 Bacteria 3648
15 Ga0123357_10061715 3300009784 Bacteria 5022
16 Ga0123353_10039098 3300010167 Bacteria 7463
17 Ga0123354_10056657 3300010882 Bacteria 5849
18 Ga0466703_129960 3300042636 Bacteria 66694
19 Ga0466709_091474 3300042648 Unclassified 13372
20 Ga0466709_095769 3300042648 Bacteria 6836
21 Ga0466711_243771 3300042615 Bacteria 56406
22 Ga0466723_260285 3300042618 Unclassified 28868
23 Ga0466706_229372 3300042599 Bacteria 4268
24 Ga0466707_127683 3300042601 Bacteria 1854
25 Ga0466722_087561 3300042609 Bacteria 5812
26 Ga0466656_139447 3300042550 Bacteria 1480
27 Ga0466657_143514 3300042582 Bacteria 5819
28 Ga0466690_254197 3300042590 Bacteria 12562
29 Ga0466733_084358 3300042659 Bacteria 46146
30 JGI24702J35022_10043642 3300002462 Bacteria 2388
31 JGI24702J35022_10048138 3300002462 Bacteria 2269
32 Ga0466729_293695 3300042621 Bacteria 1658
33 Ga0466734_008859 3300042623 Bacteria 4257
34 Ga0466704_496553 3300042643 Bacteria 2415
35 Ga0466708_160447 3300042652 Bacteria 16224
36 Ga0466708_320174 3300042652 Bacteria 10628
37 Ga0466727_045757 3300042655 Bacteria 39456
38 Ga0466710_144342 3300042613 Bacteria 61511
39 Ga0466715_279493 3300042616 Bacteria 9203
40 Ga0466729_090397 3300042621 Bacteria 10191
41 Ga0466706_114421 3300042599 Unclassified 2281
42 Ga0466707_160239 3300042601 Bacteria 3395
43 Ga0466722_041895 3300042609 Bacteria 4914
44 Ga0466690_252595 3300042590 Bacteria 114158
45 Ga0466691_176448 3300042593 Bacteria 4199
46 Ga0466694_361991 3300042594 Bacteria 1596
47 Ga0466696_017729 3300042596 Bacteria 17063
48 Ga0466696_079422 3300042596 Bacteria 3668
49 JGI24702J35022_10001142 3300002462 Unclassified 16507
50 Ga0123354_10019250 3300010882 Bacteria 10719
51 Ga0466703_043516 3300042636 Bacteria 2276
52 Ga0466709_381522 3300042648 Bacteria 1861
53 Ga0466708_447260 3300042652 Bacteria 6897
54 Ga0466725_285254 3300042654 Bacteria 86814
55 Ga0466712_080606 3300042614 Bacteria 15136
56 Ga0466711_515045 3300042615 Bacteria 4502
57 Ga0466723_107124 3300042618 Bacteria 13104
58 Ga0466729_045478 3300042621 Bacteria 7744
59 Ga0466707_219231 3300042601 Bacteria 20636
60 Ga0466716_166808 3300042605 Bacteria 20955
61 Ga0466716_226302 3300042605 Bacteria 2990
62 Ga0466719_054065 3300042606 Bacteria 43919
63 Ga0466719_408905 3300042606 Bacteria 19998
64 IMNBL1DRAFT_c0020785 3300000062 Bacteria 2645
65 JGI24702J35022_10014765 3300002462 Bacteria 4304
66 Ga0123357_10002961 3300009784 Bacteria 19199
67 Ga0123357_10009266 3300009784 Bacteria 12408
68 Ga0123353_10002133 3300010167 Bacteria 24463
69 Ga0123353_10186235 3300010167 Bacteria 3282
70 Ga0466734_166433 3300042623 Bacteria 4047
71 Ga0466704_061300 3300042643 Bacteria 59338
72 Ga0466709_399249 3300042648 Unclassified 1076
73 Ga0466710_260525 3300042613 Bacteria 27171
74 Ga0466711_195520 3300042615 Bacteria 9930
75 Ga0466718_083036 3300042617 Bacteria 2244
76 Ga0466728_199627 3300042620 Bacteria 10051
77 Ga0466707_086796 3300042601 Bacteria 101195
78 Ga0466707_112869 3300042601 Bacteria 17585
79 Ga0466719_480769 3300042606 Bacteria 9321
80 Ga0466722_029240 3300042609 Bacteria 3315
81 Ga0466690_020909 3300042590 Bacteria 3437
82 Ga0466691_055761 3300042593 Bacteria 3508
83 Ga0466705_376811 3300042612 Bacteria 16884
84 JGI24702J35022_10113077 3300002462 Bacteria 1494
85 Ga0123357_10000150 3300009784 Bacteria 61848
86 Ga0123356_10015947 3300010049 Bacteria 7185
87 Ga0123356_10038569 3300010049 Bacteria 4452
88 Ga0123356_10131483 3300010049 Bacteria 2453
89 Ga0466729_275726 3300042621 Bacteria 41765
90 Ga0466734_106007 3300042623 Bacteria 5263
91 Ga0466704_076270 3300042643 Bacteria 1957
92 Ga0466708_095666 3300042652 Bacteria 3293
93 Ga0466711_477645 3300042615 Bacteria 2801
94 Ga0466715_135746 3300042616 Bacteria 8213
95 Ga0466707_036840 3300042601 Bacteria 1259
96 Ga0466707_317426 3300042601 Bacteria 6043
97 Ga0466713_080509 3300042602 Bacteria 20268
98 Ga0466716_496339 3300042605 Bacteria 2371
99 Ga0466716_532415 3300042605 Unclassified 3886
100 Ga0466722_029539 3300042609 Bacteria 7964
101 Ga0466691_038231 3300042593 Bacteria 51865
102 JGI24702J35022_10008975 3300002462 Bacteria 5635
103 Ga0068305_10024478 3300005083 Bacteria 6558
104 Ga0072941_1034257 3300005201 Bacteria 18483
105 Ga0123354_10060476 3300010882 Bacteria 5602
106 Ga0466735_228639 3300042624 Bacteria 1132
107 Ga0466703_206623 3300042636 Bacteria 1163
108 Ga0466708_123811 3300042652 Bacteria 17627
109 Ga0466727_242004 3300042655 Bacteria 18174
110 Ga0466712_032974 3300042614 Bacteria 1404
111 Ga0466711_427238 3300042615 Bacteria 1146
112 Ga0466715_142490 3300042616 Bacteria 66178
113 Ga0466726_054270 3300042619 Bacteria 5233
114 Ga0466726_469021 3300042619 Bacteria 7644
115 Ga0466728_078707 3300042620 Bacteria 6279
116 Ga0466706_073504 3300042599 Bacteria 10036
117 Ga0466707_134212 3300042601 Bacteria 56035
118 Ga0466713_051013 3300042602 Bacteria 7998
119 Ga0466719_038880 3300042606 Bacteria 14163
120 Ga0466719_342248 3300042606 Bacteria 37604
121 Ga0466657_369934 3300042582 Bacteria 14522
122 Ga0466705_275699 3300042612 Bacteria 5491
123 Ga0466705_291286 3300042612 Bacteria 34997
124 Ga0123356_10111917 3300010049 Bacteria 2639
125 Ga0123353_10009210 3300010167 Bacteria 13590
126 Ga0123353_10317739 3300010167 Bacteria 2365
127 Ga0123353_10666034 3300010167 Bacteria 1469
128 Ga0466702_106105 3300042635 Bacteria 9220
129 Ga0466704_011548 3300042643 Bacteria 11039
130 Ga0466704_253513 3300042643 Bacteria 1440
131 Ga0466704_350064 3300042643 Bacteria 25347
132 Ga0466704_491869 3300042643 Unclassified 8447
133 Ga0466708_029826 3300042652 Bacteria 6505
134 Ga0466723_136992 3300042618 Bacteria 12657
135 Ga0466723_216336 3300042618 Bacteria 1671
136 Ga0466726_462797 3300042619 Bacteria 11323
137 Ga0466729_135466 3300042621 Bacteria 44776
138 Ga0466706_047989 3300042599 Bacteria 4741
139 Ga0466700_338689 3300042600 Bacteria 6023
140 Ga0466707_139530 3300042601 Bacteria 6430
141 Ga0466713_075329 3300042602 Bacteria 69428
142 Ga0466716_337653 3300042605 Bacteria 4641
143 Ga0466657_015987 3300042582 Bacteria 12122
144 Ga0466657_401865 3300042582 Bacteria 115966
145 Ga0466692_128210 3300042591 Bacteria 14398
146 Ga0466692_173863 3300042591 Bacteria 18477
147 Ga0466691_026950 3300042593 Bacteria 2964

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042582 Ga0466657_143514 Ga0466657_143514_5127_5807 226
2 3300042621 Ga0466729_293695 Ga0466729_293695_13_693 226
3 3300042659 Ga0466733_084358 Ga0466733_084358_42761_43504 226
4 3300010167 Ga0123353_10002133 Ga0123353_1000213315 227
5 3300042611 Ga0466697_065264 Ga0466697_065264_222_962 229
6 3300010167 Ga0123353_10666034 Ga0123353_106660342 232
7 3300042606 Ga0466719_408905 Ga0466719_408905_4312_5079 245
8 3300042550 Ga0466656_139447 Ga0466656_139447_339_1079 246
9 3300042582 Ga0466657_015987 Ga0466657_015987_8303_9043 246
10 3300042582 Ga0466657_054897 Ga0466657_054897_733_1473 246
11 3300042582 Ga0466657_369934 Ga0466657_369934_7194_7934 246
12 3300042582 Ga0466657_401865 Ga0466657_401865_54195_54935 246
13 3300042590 Ga0466690_020909 Ga0466690_020909_1656_2396 246
14 3300042590 Ga0466690_252595 Ga0466690_252595_63299_64039 246
15 3300042590 Ga0466690_254197 Ga0466690_254197_4718_5458 246
16 3300042591 Ga0466692_128210 Ga0466692_128210_2337_3077 246
17 3300042591 Ga0466692_173863 Ga0466692_173863_6753_7493 246
18 3300042593 Ga0466691_026950 Ga0466691_026950_1099_1839 246
19 3300042593 Ga0466691_055761 Ga0466691_055761_1774_2514 246
20 3300042593 Ga0466691_176448 Ga0466691_176448_2762_3502 246
21 3300042596 Ga0466696_017729 Ga0466696_017729_8725_9465 246
22 3300042596 Ga0466696_079422 Ga0466696_079422_1397_2137 246
23 3300042601 Ga0466707_112869 Ga0466707_112869_14489_15229 246
24 3300042601 Ga0466707_134212 Ga0466707_134212_50054_50794 246
25 3300042601 Ga0466707_139530 Ga0466707_139530_3000_3740 246
26 3300042601 Ga0466707_160239 Ga0466707_160239_618_1358 246
27 3300042601 Ga0466707_219231 Ga0466707_219231_12186_12926 246
28 3300042601 Ga0466707_317426 Ga0466707_317426_1426_2166 246
29 3300042602 Ga0466713_051013 Ga0466713_051013_256_996 246
30 3300042602 Ga0466713_080509 Ga0466713_080509_740_1480 246
31 3300042605 Ga0466716_166808 Ga0466716_166808_15203_15943 246
32 3300042605 Ga0466716_337653 Ga0466716_337653_2335_3075 246
33 3300042606 Ga0466719_054065 Ga0466719_054065_41848_42588 246
34 3300042609 Ga0466722_029240 Ga0466722_029240_2430_3170 246
35 3300042609 Ga0466722_029539 Ga0466722_029539_6219_6959 246
36 3300042612 Ga0466705_022003 Ga0466705_022003_6652_7392 246
37 3300042612 Ga0466705_257618 Ga0466705_257618_454_1194 246
38 3300042612 Ga0466705_275699 Ga0466705_275699_2986_3726 246
39 3300042612 Ga0466705_291286 Ga0466705_291286_16082_16822 246
40 3300042613 Ga0466710_144342 Ga0466710_144342_59655_60395 246
41 3300042613 Ga0466710_260525 Ga0466710_260525_24799_25539 246
42 3300042615 Ga0466711_195520 Ga0466711_195520_8123_8863 246
43 3300042616 Ga0466715_369080 Ga0466715_369080_15152_15892 246
44 3300042618 Ga0466723_107124 Ga0466723_107124_4732_5472 246
45 3300042618 Ga0466723_216336 Ga0466723_216336_307_1047 246
46 3300042618 Ga0466723_260285 Ga0466723_260285_24433_25173 246
47 3300042619 Ga0466726_054270 Ga0466726_054270_1040_1780 246
48 3300042619 Ga0466726_278257 Ga0466726_278257_10397_11137 246
49 3300042620 Ga0466728_078707 Ga0466728_078707_2510_3250 246
50 3300042621 Ga0466729_090397 Ga0466729_090397_8326_9066 246
51 3300042621 Ga0466729_135466 Ga0466729_135466_475_1215 246
52 3300042623 Ga0466734_008859 Ga0466734_008859_2558_3298 246
53 3300042623 Ga0466734_106007 Ga0466734_106007_2923_3663 246
54 3300042624 Ga0466735_228639 Ga0466735_228639_54_794 246
55 3300042636 Ga0466703_043516 Ga0466703_043516_954_1694 246
56 3300042636 Ga0466703_129960 Ga0466703_129960_64179_64919 246
57 3300042636 Ga0466703_181666 Ga0466703_181666_457_1197 246
58 3300042636 Ga0466703_206623 Ga0466703_206623_131_871 246
59 3300042643 Ga0466704_061300 Ga0466704_061300_18639_19379 246
60 3300042643 Ga0466704_076270 Ga0466704_076270_175_915 246
61 3300042643 Ga0466704_253513 Ga0466704_253513_683_1423 246
62 3300042643 Ga0466704_350064 Ga0466704_350064_1115_1855 246
63 3300042643 Ga0466704_491869 Ga0466704_491869_4984_5724 246
64 3300042643 Ga0466704_496553 Ga0466704_496553_534_1274 246
65 3300042648 Ga0466709_091474 Ga0466709_091474_7704_8444 246
66 3300042648 Ga0466709_095769 Ga0466709_095769_2833_3573 246
67 3300042648 Ga0466709_381522 Ga0466709_381522_868_1608 246
68 3300042652 Ga0466708_029826 Ga0466708_029826_5005_5745 246
69 3300042652 Ga0466708_320174 Ga0466708_320174_5019_5795 246
70 3300042654 Ga0466725_018948 Ga0466725_018948_11110_11850 246
71 3300042654 Ga0466725_285254 Ga0466725_285254_85103_85843 246
72 3300042655 Ga0466727_045757 Ga0466727_045757_32862_33602 246
73 3300042655 Ga0466727_242004 Ga0466727_242004_16547_17287 246
74 iso_pr_bacteria 2820042117 2820043201 246
75 iso_pr_bacteria 2820084079 2820086258 246
76 iso_pr_bacteria 2820086750 2820088695 246
77 iso_pr_bacteria 2820089333 2820090136 246
78 iso_pr_bacteria 2820121232 2820122885 246
79 iso_pr_bacteria 2820131053 2820132632 246
80 iso_pr_bacteria 2820152154 2820152553 246
81 iso_pr_bacteria 2864808494 2864810869 246
82 iso_pr_bacteria 2864812326 2864814201 246
83 iso_pr_bacteria 2891720358 2891722211 246
84 3300002462 JGI24702J35022_10001142 JGI24702J35022_100011426 247
85 3300002462 JGI24702J35022_10048138 JGI24702J35022_100481383 247
86 3300002462 JGI24702J35022_10113077 JGI24702J35022_101130772 247
87 3300009784 Ga0123357_10002961 Ga0123357_100029619 247
88 3300010049 Ga0123356_10038569 Ga0123356_100385694 247
89 3300010049 Ga0123356_10111917 Ga0123356_101119172 247
90 3300010049 Ga0123356_10131483 Ga0123356_101314833 247
91 3300010167 Ga0123353_10039098 Ga0123353_100390983 247
92 3300010882 Ga0123354_10019250 Ga0123354_100192502 247
93 3300010882 Ga0123354_10060476 Ga0123354_100604763 247
94 3300042609 Ga0466722_041895 Ga0466722_041895_3347_4090 247
95 3300042609 Ga0466722_087561 Ga0466722_087561_3337_4080 247
96 iso_pr_bacteria 2820062699 2820063850 247
97 iso_pr_bacteria 2820065746 2820067370 247
98 iso_pr_bacteria 2820103659 2820105896 247
99 iso_pr_bacteria 2864755708 2864759301 247
100 3300002504 JGI24705J35276_12237100 JGI24705J35276_122371004 248
101 3300009784 Ga0123357_10009266 Ga0123357_1000926610 248
102 3300042643 Ga0466704_011548 Ga0466704_011548_9973_10719 248
103 iso_pr_bacteria 2501651205 2501713371 248
104 iso_pr_bacteria 2585427605 2585887537 248
105 iso_pr_bacteria 2585428048 2587692237 248
106 iso_pr_bacteria 2820123897 2820126560 248
107 3300009784 Ga0123357_10000150 Ga0123357_1000015023 249
108 3300042590 Ga0466690_066435 Ga0466690_066435_5640_6431 249
109 3300042599 Ga0466706_047989 Ga0466706_047989_1344_2093 249
110 3300042615 Ga0466711_427238 Ga0466711_427238_309_1091 249
111 iso_pr_bacteria 2820075487 2820075808 249
112 iso_pr_bacteria 2864859030 2864859078 249
113 iso_pr_bacteria 2864914039 2864914087 249
114 iso_pr_bacteria 2864988360 2864988408 249
115 3300010049 Ga0123356_10015947 Ga0123356_100159472 250
116 3300010167 Ga0123353_10009210 Ga0123353_100092106 250
117 3300042616 Ga0466715_135746 Ga0466715_135746_4004_4795 251
118 3300042606 Ga0466719_342248 Ga0466719_342248_26199_26981 252
119 3300042652 Ga0466708_160447 Ga0466708_160447_7257_8024 255
120 3300042615 Ga0466711_477645 Ga0466711_477645_834_1607 257
121 iso_pr_bacteria 2820644600 2820645384 257
122 3300042606 Ga0466719_038880 Ga0466719_038880_4727_5503 258
123 3300042652 Ga0466708_123811 Ga0466708_123811_2408_3184 258
124 iso_pr_bacteria 2820408893 2820409906 258
125 3300010882 Ga0123354_10056657 Ga0123354_100566571 259
126 3300042601 Ga0466707_127683 Ga0466707_127683_41_820 259
127 3300042606 Ga0466719_480769 Ga0466719_480769_1047_1826 259
128 3300042615 Ga0466711_243771 Ga0466711_243771_10118_10897 259
129 3300042615 Ga0466711_515045 Ga0466711_515045_1332_2111 259
130 3300042621 Ga0466729_275726 Ga0466729_275726_39407_40186 259
131 iso_pr_bacteria 2820050117 2820050633 259
132 3300005201 Ga0072941_1199762 Ga0072941_11997622 260
133 3300042599 Ga0466706_114421 Ga0466706_114421_256_1038 260
134 3300042601 Ga0466707_086796 Ga0466707_086796_22279_23061 260
135 3300042605 Ga0466716_226302 Ga0466716_226302_1051_1833 260
136 3300042605 Ga0466716_532415 Ga0466716_532415_2913_3695 260
137 3300042612 Ga0466705_376811 Ga0466705_376811_11735_12517 260
138 3300042616 Ga0466715_142490 Ga0466715_142490_45664_46446 260
139 3300042616 Ga0466715_279493 Ga0466715_279493_8207_8989 260
140 3300042619 Ga0466726_462797 Ga0466726_462797_3737_4519 260
141 3300042619 Ga0466726_469021 Ga0466726_469021_4858_5640 260
142 3300042652 Ga0466708_095666 Ga0466708_095666_1306_2088 260
143 3300002462 JGI24702J35022_10014765 JGI24702J35022_100147652 261
144 3300009784 Ga0123357_10061715 Ga0123357_100617152 261
145 3300042591 Ga0466692_157774 Ga0466692_157774_39602_40387 261
146 3300042620 Ga0466728_199627 Ga0466728_199627_971_1756 261
147 iso_pr_bacteria 2820047982 2820048195 261
148 3300002462 JGI24702J35022_10008975 JGI24702J35022_100089755 262
149 3300042593 Ga0466691_038231 Ga0466691_038231_13862_14653 263
150 3300042605 Ga0466716_496339 Ga0466716_496339_1414_2205 263
151 3300042618 Ga0466723_136992 Ga0466723_136992_11306_12097 263
152 3300042635 Ga0466702_106105 Ga0466702_106105_962_1753 263
153 3300042636 Ga0466703_292925 Ga0466703_292925_1408_2199 263
154 3300042648 Ga0466709_399249 Ga0466709_399249_26_817 263
155 3300000062 IMNBL1DRAFT_c0020785 IMNBL1DRAFT_00207853 264
156 3300042652 Ga0466708_447260 Ga0466708_447260_3917_4717 266
157 3300010167 Ga0123353_10186235 Ga0123353_101862354 268
158 3300042600 Ga0466700_338689 Ga0466700_338689_1233_2039 268
159 3300042623 Ga0466734_142851 Ga0466734_142851_740_1546 268
160 3300042594 Ga0466694_361991 Ga0466694_361991_670_1479 269
161 3300042599 Ga0466706_073504 Ga0466706_073504_6226_7065 269
162 3300042623 Ga0466734_166433 Ga0466734_166433_2800_3609 269
163 3300002462 JGI24702J35022_10043642 JGI24702J35022_100436423 270
164 3300005201 Ga0072941_1034257 Ga0072941_103425716 270
165 3300010167 Ga0123353_10317739 Ga0123353_103177393 271
166 3300042614 Ga0466712_032974 Ga0466712_032974_86_904 272
167 3300042614 Ga0466712_080606 Ga0466712_080606_6713_7531 272
168 3300042602 Ga0466713_075329 Ga0466713_075329_45516_46337 273
169 3300042617 Ga0466718_083036 Ga0466718_083036_1263_2084 273
170 3300005083 Ga0068305_10024478 Ga0068305_100244783 274
171 3300042621 Ga0466729_045478 Ga0466729_045478_5782_6606 274
172 3300042601 Ga0466707_036840 Ga0466707_036840_202_1029 275
173 3300042599 Ga0466706_229372 Ga0466706_229372_248_1090 280

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01618 MotA_ExbB MotA/TolQ/ExbB proton channel family 107 223 0.98
PF20560 MotA_N Motility protein A N-terminal 9 84 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.