Protein Family IF05677

Metagenome Isolate
143 Members
88 Samples
101 Scaffolds
167.04 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_226472|Ga0466706_226472_292_888
Length
198 aa
Sequence
MLTFASIFNKFSPQNYIKSESLLPLRLIKIHIDMAITHFQGTEVKTSGTLPAVGAQAPNFTLVKSDLSALSLSDLKGKQVVLNIFPSIDTGVCAASVRRFNKEAATLAGAVVLCISKDLPFAQARFCGAEGLNNVVTLSDFRTADFANHYGVLQQDGPLAGLLARAVVVIDAAGKVKYSQLVSEITHEPDYEAALAAL

📊 Sample Types

Isolate 29.4%
Metagenome 70.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 30.6%
Termitidae 15.3%
Tenebrionidae 9.4%
Kalotermitidae 8.2%
Elmidae 7.1%
Culicidae 7.1%
Drosophilidae 3.5%
Formicidae 3.5%
Termopsidae 2.4%
Rhinotermitidae 2.4%
Armadillidiidae 2.4%
Nephropidae 1.2%
Apidae 1.2%
Cambaridae 1.2%
Bombycidae 1.2%
Hydrophilidae 1.2%
Passalidae 1.2%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 133
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
2 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
3 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
4 2820101058 Unclassified Proteobacteria Emb289P4bin76 Isolate Unclassified
5 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
6 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
7 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
8 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
9 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
10 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
11 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
12 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
13 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
14 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
15 2931425734 Nocardioides sp. J2M5 Isolate
16 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
17 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
20 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
21 2904728850 Flavobacterium sp. xlx-214 Isolate
22 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
23 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
31 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
32 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
33 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
34 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
35 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
36 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
37 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
38 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
39 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
40 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
41 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
42 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
43 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
44 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
45 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
46 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
47 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
48 2791355473 Vibrio barjaei 3062 Isolate Unclassified
49 3006242587 Vibrio sp. RE86 Isolate Unclassified
50 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
51 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
52 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
53 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
54 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
55 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
56 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
57 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
58 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
59 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
60 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
61 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
62 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
63 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
64 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
65 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
66 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
67 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
68 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
69 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
70 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
71 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
72 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
73 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
74 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
75 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
76 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
77 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
78 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
79 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
80 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
81 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
82 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
83 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
84 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
85 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
86 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
87 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
88 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562378_0783 3300056814 Unclassified 43780
2 Ga0562376_1969 3300056857 Unclassified 26674
3 Ga0466715_377145 3300042616 Bacteria 1874
4 Ga0466726_460030 3300042619 Bacteria 9201
5 Ga0466706_153926 3300042599 Bacteria 20845
6 Ga0466706_265143 3300042599 Bacteria 31444
7 Ga0103263_110404 3300007042 Bacteria 952
8 Ga0104050_1001037 3300007153 Bacteria 5063
9 Ga0160443_101490 3300012848 Unclassified 7722
10 Ga0466657_386076 3300042582 Bacteria 4593
11 Ga0466692_099698 3300042591 Bacteria 1389
12 Ga0562377_0064 3300056842 Bacteria 457777
13 Ga0562375_0623 3300056856 Unclassified 66838
14 Ga0562376_0047 3300056857 Bacteria 307693
15 Ga0466713_068004 3300042602 Bacteria 5104
16 Ga0466713_099099 3300042602 Bacteria 5989
17 Ga0466730_054806 3300042625 Bacteria 801523
18 Ga0466727_235056 3300042655 Bacteria 3957
19 Ga0160458_100038 3300012832 Bacteria 185944
20 Ga0466701_014350 3300042598 Bacteria 68002
21 Ga0562379_0589 3300056790 Bacteria 66171
22 Ga0562379_1569 3300056790 Bacteria 25020
23 Ga0562378_0680 3300056814 Bacteria 49864
24 Ga0562376_0013 3300056857 Bacteria 733279
25 Ga0160470_100012 3300012813 Bacteria 373404
26 Ga0466700_202355 3300042600 Bacteria 2307
27 Ga0466713_065581 3300042602 Bacteria 52137
28 Ga0466704_558121 3300042643 Bacteria 1179
29 Ga0466708_193832 3300042652 Bacteria 7211
30 Ga0466727_075887 3300042655 Bacteria 14934
31 Ga0466727_324657 3300042655 Bacteria 25319
32 Ga0068305_10844136 3300005083 Unclassified 794
33 Ga0103261_1006430 3300007083 Bacteria 1705
34 Ga0104048_1002343 3300007143 Unclassified 3140
35 Ga0104050_1005356 3300007153 Bacteria 10776
36 Ga0562379_0066 3300056790 Bacteria 440869
37 Ga0562379_1039 3300056790 Bacteria 38074
38 Ga0466707_388089 3300042601 Bacteria 4149
39 Ga0466724_09284 3300042649 Bacteria 258546
40 Ga0466724_10389 3300042649 Bacteria 45795
41 Ga0466724_27125 3300042649 Bacteria 132200
42 Ga0466708_282167 3300042652 Bacteria 9301
43 Ga0466727_073096 3300042655 Bacteria 5704
44 Ga0068305_10173155 3300005083 Unclassified 1959
45 Ga0530661_001065 3300056564 Bacteria 15771
46 Ga0562378_0341 3300056814 Bacteria 91004
47 Ga0562378_1664 3300056814 Unclassified 22791
48 Ga0562374_0768 3300057007 Bacteria 46501
49 Ga0123357_10162047 3300009784 Bacteria 2677
50 Ga0123356_10020826 3300010049 Bacteria 6202
51 Ga0466706_106428 3300042599 Bacteria 2062
52 Ga0466706_226472 3300042599 Bacteria 2480
53 Ga0466713_085517 3300042602 Bacteria 4751
54 Ga0466713_123258 3300042602 Bacteria 55709
55 Ga0466704_269443 3300042643 Bacteria 3521
56 Ga0466727_298400 3300042655 Bacteria 5899
57 JGI24702J35022_10092381 3300002462 Bacteria 1648
58 Ga0466705_009364 3300042612 Bacteria 2029
59 Ga0562375_0001 3300056856 Bacteria 3661630
60 Ga0562375_0026 3300056856 Bacteria 725899
61 Ga0466715_068634 3300042616 Bacteria 15808
62 Ga0123353_10374328 3300010167 Bacteria 2133
63 Ga0123353_11482745 3300010167 Bacteria 865
64 Ga0466719_532993 3300042606 Bacteria 2574
65 Ga0466698_342286 3300042610 Bacteria 2066
66 Ga0466730_021757 3300042625 Bacteria 584842
67 Ga0466708_182369 3300042652 Bacteria 2792
68 Ga0466708_298806 3300042652 Bacteria 30247
69 IMNBGM34_c000009 3300000036 Bacteria 55175
70 JGI24705J35276_12174540 3300002504 Bacteria 1318
71 CVPL005L_10002799 3300002938 Bacteria 19810
72 Ga0123357_10000004 3300009784 Bacteria 308216
73 Ga0466701_009529 3300042598 Bacteria 375690
74 Ga0466733_072342 3300042659 Bacteria 18235
75 Ga0562377_0009 3300056842 Bacteria 1580355
76 Ga0562375_0950 3300056856 Bacteria 46257
77 Ga0562376_1165 3300056857 Bacteria 38778
78 Ga0562376_3820 3300056857 Unclassified 14241
79 Ga0466715_558707 3300042616 Unclassified 1541
80 Ga0123356_10000783 3300010049 Bacteria 35212
81 Ga0123353_10007576 3300010167 Bacteria 14709
82 Ga0466701_035038 3300042598 Bacteria 14108
83 Ga0466701_070278 3300042598 Bacteria 16896
84 Ga0466729_285413 3300042621 Bacteria 7321
85 Ga0466724_09429 3300042649 Bacteria 389876
86 Ga0103261_1001667 3300007083 Bacteria 3545
87 Ga0160443_100006 3300012848 Bacteria 647325
88 Ga0562377_1369 3300056842 Bacteria 25963
89 Ga0562376_4072 3300056857 Bacteria 13173
90 Ga0466715_031980 3300042616 Bacteria 5409
91 Ga0466715_471823 3300042616 Bacteria 8826
92 Ga0466726_076089 3300042619 Bacteria 25678
93 Ga0123354_10000063 3300010882 Bacteria 79556
94 Ga0466701_046051 3300042598 Bacteria 26733
95 Ga0466713_085462 3300042602 Bacteria 2811
96 Ga0466713_145073 3300042602 Bacteria 14313
97 Ga0466703_371370 3300042636 Bacteria 5830
98 Ga0104045_1023622 3300007085 Bacteria 4847
99 Ga0104045_1087002 3300007085 Bacteria 815
100 Ga0160445_100402 3300012847 Bacteria 23842
101 Ga0466696_354605 3300042596 Bacteria 8905

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00578 AhpC-TSA AhpC/TSA family 53 178 0.97
PF08534 Redoxin Redoxin 53 195 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08534 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.