Protein Family IF05656

Metagenome Isolate
184 Members
62 Samples
169 Scaffolds
244.7 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_197440|Ga0466706_197440_18861_19688
Length
275 aa
Sequence
MTAANLQQWIRHPEQLSRDTLYELRTVVARYPYFQAARLLYLKNLYLLHDADFGAELRRAVIYVGDRRVLFLLIEGDNFVERLKRKNEANGSGETAPDITEPSVDRTLALIDAFLATVPSDLHAPTSLDYTVDYTSYLLDTPVEPAADGDDECPKLKGQSLIDDFIEQNADTRRTPKSPVNRETGETPEAGTDEATDVNIGEDDEKETPKESFAEAEADDGYFTETLAHIYIRQRRYSKALEIIRRLSLKYPQKNTYFADQIRFLEKLIINANSK

📊 Sample Types

Isolate 8.2%
Metagenome 91.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.5%
Kalotermitidae 23.0%
Blattidae 18.0%
Unclassified 11.5%
Termopsidae 6.6%
Rhinotermitidae 4.9%
Passalidae 4.9%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 184
Eukaryota 0
Viruses 0
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2922326829 Bacteroides sp. 224 Isolate Blattidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2923982719 Parabacteroides sp. 52 Isolate Blattidae
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
20 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
21 3004667792 Bacteroides sp. 519 Isolate Blattidae
22 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
29 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
30 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
31 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
32 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
33 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
34 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
35 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
38 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
43 3004677695 Bacteroides sp. 214 Isolate Blattidae
44 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
48 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
49 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
52 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
53 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
54 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
55 3004672520 Bacteroides sp. 51 Isolate Blattidae
56 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
57 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
58 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
59 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
60 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
61 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
62 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_012247 3300042599 Bacteria 6840
2 Ga0466706_115643 3300042599 Bacteria 11447
3 Ga0466700_304523 3300042600 Bacteria 3726
4 Ga0466707_109853 3300042601 Bacteria 18130
5 Ga0466713_045299 3300042602 Bacteria 8584
6 Ga0466722_008321 3300042609 Bacteria 8234
7 2227532116 2225789004 Bacteria 3134
8 JGI24702J35022_10044568 3300002462 Bacteria 2364
9 Ga0123357_10028511 3300009784 Bacteria 7559
10 Ga0123354_10010789 3300010882 Bacteria 14099
11 Ga0466705_036506 3300042612 Bacteria 5725
12 Ga0466710_436274 3300042613 Bacteria 4721
13 Ga0466715_057006 3300042616 Bacteria 8544
14 Ga0466715_083069 3300042616 Bacteria 26157
15 Ga0466656_187408 3300042550 Bacteria 7556
16 Ga0466690_113175 3300042590 Bacteria 17999
17 Ga0466690_245129 3300042590 Bacteria 16092
18 Ga0466693_278342 3300042592 Bacteria 1518
19 Ga0466691_082783 3300042593 Bacteria 28065
20 Ga0466696_302479 3300042596 Bacteria 58494
21 Ga0466735_068691 3300042624 Bacteria 9917
22 Ga0466724_33989 3300042649 Bacteria 1249
23 Ga0466727_138028 3300042655 Bacteria 18367
24 Ga0466706_074761 3300042599 Bacteria 5280
25 Ga0466706_259930 3300042599 Bacteria 14269
26 Ga0466713_081814 3300042602 Bacteria 6368
27 Ga0466716_078621 3300042605 Bacteria 19363
28 Ga0466716_320693 3300042605 Bacteria 2960
29 Ga0466716_340066 3300042605 Bacteria 22650
30 2227468526 2225789004 Bacteria 5003
31 IMNBL1DRAFT_c0008449 3300000062 Bacteria 5236
32 JGI24702J35022_10054553 3300002462 Bacteria 2132
33 JGI24702J35022_10097548 3300002462 Bacteria 1605
34 JGI24699J35502_11134227 3300002509 Bacteria 76542
35 Ga0123353_10183156 3300010167 Bacteria 3314
36 Ga0466711_220936 3300042615 Bacteria 6473
37 Ga0466690_149426 3300042590 Bacteria 7591
38 Ga0466691_022426 3300042593 Bacteria 71333
39 Ga0466696_074059 3300042596 Bacteria 10856
40 Ga0466735_200050 3300042624 Bacteria 3881
41 Ga0466703_239733 3300042636 Bacteria 28849
42 Ga0466704_052221 3300042643 Bacteria 9879
43 Ga0466727_011844 3300042655 Bacteria 5311
44 Ga0466727_240150 3300042655 Bacteria 3115
45 Ga0466706_161606 3300042599 Bacteria 2580
46 Ga0466707_264855 3300042601 Bacteria 1078
47 Ga0466713_028113 3300042602 Bacteria 7191
48 Ga0466713_082046 3300042602 Bacteria 24947
49 Ga0466733_096868 3300042659 Bacteria 74750
50 Ga0466733_213890 3300042659 Bacteria 4087
51 2227063698 2225789003 Bacteria 16706
52 2227527402 2225789004 Bacteria 16682
53 IMNBL1DRAFT_c0003741 3300000062 Bacteria 9531
54 JGI24696J40584_12924354 3300002834 Bacteria 1387
55 Ga0068305_10073289 3300005083 Bacteria 3926
56 Ga0466697_258576 3300042611 Bacteria 357278
57 Ga0466705_112010 3300042612 Bacteria 1056
58 Ga0466711_476288 3300042615 Bacteria 8644
59 Ga0466728_220670 3300042620 Bacteria 33359
60 Ga0466690_248909 3300042590 Bacteria 9190
61 Ga0466690_375807 3300042590 Bacteria 12353
62 Ga0466692_131879 3300042591 Bacteria 47901
63 Ga0466691_012716 3300042593 Bacteria 19248
64 Ga0466696_287535 3300042596 Bacteria 43348
65 Ga0466735_046855 3300042624 Bacteria 10270
66 Ga0466735_149918 3300042624 Bacteria 3613
67 Ga0466703_079229 3300042636 Bacteria 1511
68 Ga0466704_154577 3300042643 Bacteria 5663
69 Ga0466709_405290 3300042648 Bacteria 5024
70 Ga0466708_185973 3300042652 Bacteria 10794
71 Ga0466727_225870 3300042655 Bacteria 4480
72 Ga0466706_197440 3300042599 Bacteria 24639
73 Ga0466716_025507 3300042605 Bacteria 2046
74 JGI24699J35502_11134123 3300002509 Bacteria 34108
75 Ga0068302_10041915 3300005071 Bacteria 10017
76 Ga0123357_10025099 3300009784 Bacteria 8035
77 Ga0466715_431927 3300042616 Bacteria 29895
78 Ga0466726_231922 3300042619 Bacteria 4030
79 Ga0466729_180265 3300042621 Bacteria 15549
80 Ga0466694_333659 3300042594 Bacteria 7378
81 Ga0466735_120177 3300042624 Bacteria 1130
82 Ga0466735_154167 3300042624 Bacteria 2480
83 Ga0466704_073764 3300042643 Bacteria 58999
84 Ga0466704_116828 3300042643 Bacteria 10950
85 Ga0466704_121749 3300042643 Bacteria 14567
86 Ga0466708_257049 3300042652 Bacteria 1566
87 Ga0466727_249777 3300042655 Bacteria 11525
88 Ga0466713_089753 3300042602 Bacteria 35618
89 Ga0466716_535552 3300042605 Bacteria 5568
90 Ga0466722_043134 3300042609 Bacteria 89421
91 Ga0466722_244426 3300042609 Bacteria 2083
92 Ga0068305_10037746 3300005083 Bacteria 21674
93 Ga0466711_011264 3300042615 Bacteria 6001
94 Ga0466711_100420 3300042615 Bacteria 9741
95 Ga0466715_034225 3300042616 Bacteria 16942
96 Ga0466715_063927 3300042616 Bacteria 20242
97 Ga0466715_110752 3300042616 Bacteria 8045
98 Ga0466728_016383 3300042620 Bacteria 48703
99 Ga0265387_1007104 3300024582 Bacteria 1502
100 Ga0466657_385427 3300042582 Bacteria 4202
101 Ga0466690_069343 3300042590 Bacteria 17759
102 Ga0466690_334959 3300042590 Bacteria 17522
103 Ga0466692_202144 3300042591 Bacteria 41419
104 Ga0466693_065613 3300042592 Bacteria 1284
105 Ga0466691_098703 3300042593 Bacteria 4700
106 Ga0466703_148815 3300042636 Bacteria 16579
107 Ga0466703_176934 3300042636 Bacteria 5044
108 Ga0466703_232598 3300042636 Bacteria 11554
109 Ga0466703_250134 3300042636 Bacteria 18299
110 Ga0466704_094066 3300042643 Bacteria 24442
111 Ga0466708_289367 3300042652 Bacteria 4187
112 Ga0466706_060160 3300042599 Bacteria 4112
113 Ga0466706_118269 3300042599 Bacteria 2336
114 Ga0466719_065003 3300042606 Bacteria 9724
115 Ga0466719_541364 3300042606 Bacteria 3220
116 Ga0466722_132116 3300042609 Bacteria 5856
117 Ga0466722_263608 3300042609 Bacteria 34147
118 Ga0466733_030815 3300042659 Bacteria 19476
119 JGI24705J35276_12238107 3300002504 Bacteria 15966
120 Ga0123357_10008856 3300009784 Bacteria 12635
121 Ga0123356_10033934 3300010049 Bacteria 4772
122 Ga0466711_196937 3300042615 Bacteria 36467
123 Ga0466723_014851 3300042618 Bacteria 13167
124 Ga0466723_070186 3300042618 Bacteria 30269
125 Ga0466691_007963 3300042593 Bacteria 6577
126 Ga0466696_229029 3300042596 Bacteria 4520
127 Ga0466735_013515 3300042624 Bacteria 4734
128 Ga0466703_233451 3300042636 Bacteria 2301
129 Ga0466704_151669 3300042643 Bacteria 5189
130 Ga0466708_014247 3300042652 Bacteria 21773
131 Ga0466725_064754 3300042654 Bacteria 6296
132 Ga0466725_193589 3300042654 Bacteria 4127
133 Ga0466706_255100 3300042599 Bacteria 11194
134 Ga0466700_461092 3300042600 Bacteria 1139
135 Ga0466707_132567 3300042601 Bacteria 1930
136 Ga0466716_506150 3300042605 Bacteria 11490
137 Ga0466719_079549 3300042606 Bacteria 6297
138 JGI24702J35022_10001952 3300002462 Bacteria 12711
139 JGI24702J35022_10195092 3300002462 Bacteria 1156
140 JGI24705J35276_12213483 3300002504 Bacteria 1926
141 Ga0123354_10071882 3300010882 Bacteria 4988
142 Ga0466715_193888 3300042616 Bacteria 87863
143 Ga0466715_624866 3300042616 Bacteria 14808
144 Ga0466723_047289 3300042618 Bacteria 12837
145 Ga0466726_485037 3300042619 Bacteria 18142
146 Ga0466692_047378 3300042591 Bacteria 93081
147 Ga0466735_102645 3300042624 Bacteria 21461
148 Ga0466704_532198 3300042643 Bacteria 2561
149 Ga0466708_060683 3300042652 Bacteria 49198
150 Ga0466708_233940 3300042652 Bacteria 9713
151 Ga0466727_119767 3300042655 Bacteria 1410
152 Ga0466706_245430 3300042599 Bacteria 57044
153 Ga0466707_320477 3300042601 Bacteria 18661
154 Ga0466713_072265 3300042602 Bacteria 40264
155 Ga0466713_109063 3300042602 Bacteria 21346
156 Ga0466719_236394 3300042606 Bacteria 1007
157 IMNBL1DRAFT_c0000298 3300000062 Bacteria 42272
158 IMNBL1DRAFT_c0004532 3300000062 Bacteria 8302
159 Ga0123354_10333812 3300010882 Bacteria 1378
160 Ga0466705_147814 3300042612 Bacteria 1019
161 Ga0466710_117443 3300042613 Bacteria 10725
162 Ga0466711_028440 3300042615 Bacteria 19103
163 Ga0466711_083476 3300042615 Bacteria 22236
164 Ga0466715_173384 3300042616 Bacteria 14345
165 Ga0466692_048325 3300042591 Bacteria 14646
166 Ga0466735_114938 3300042624 Bacteria 1450
167 Ga0466703_175370 3300042636 Bacteria 7579
168 Ga0466709_110644 3300042648 Bacteria 26395
169 Ga0466727_059108 3300042655 Bacteria 16126

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042649 Ga0466724_33989 Ga0466724_33989_37_696 219
2 3300010049 Ga0123356_10033934 Ga0123356_100339345 222
3 3300042601 Ga0466707_264855 Ga0466707_264855_18_686 222
4 3300002462 JGI24702J35022_10001952 JGI24702J35022_100019525 223
5 3300042594 Ga0466694_333659 Ga0466694_333659_6391_7167 223
6 3300042643 Ga0466704_052221 Ga0466704_052221_5407_6117 224
7 3300042652 Ga0466708_233940 Ga0466708_233940_1097_1771 224
8 3300042652 Ga0466708_289367 Ga0466708_289367_1097_1771 224
9 3300042616 Ga0466715_034225 Ga0466715_034225_6824_7567 225
10 3300042655 Ga0466727_059108 Ga0466727_059108_4591_5328 225
11 3300042616 Ga0466715_431927 Ga0466715_431927_7903_8583 226
12 3300042601 Ga0466707_109853 Ga0466707_109853_12008_12757 227
13 3300042590 Ga0466690_248909 Ga0466690_248909_5164_5880 229
14 3300042606 Ga0466719_079549 Ga0466719_079549_2698_3387 229
15 3300042655 Ga0466727_011844 Ga0466727_011844_960_1700 229
16 3300042655 Ga0466727_249777 Ga0466727_249777_713_1507 229
17 3300042612 Ga0466705_036506 Ga0466705_036506_311_1063 230
18 3300042618 Ga0466723_014851 Ga0466723_014851_11485_12177 230
19 3300042620 Ga0466728_220670 Ga0466728_220670_30165_30905 230
20 3300042624 Ga0466735_114938 Ga0466735_114938_171_863 230
21 3300042599 Ga0466706_060160 Ga0466706_060160_3314_4009 231
22 3300042619 Ga0466726_485037 Ga0466726_485037_15984_16679 231
23 3300042636 Ga0466703_079229 Ga0466703_079229_104_841 231
24 3300042655 Ga0466727_138028 Ga0466727_138028_6521_7216 231
25 3300010167 Ga0123353_10183156 Ga0123353_101831562 232
26 3300042590 Ga0466690_334959 Ga0466690_334959_11337_12068 232
27 3300042602 Ga0466713_089753 Ga0466713_089753_1488_2189 233
28 3300042605 Ga0466716_506150 Ga0466716_506150_10344_11105 233
29 3300042624 Ga0466735_068691 Ga0466735_068691_5247_5948 233
30 3300042643 Ga0466704_094066 Ga0466704_094066_847_1584 233
31 3300042652 Ga0466708_257049 Ga0466708_257049_585_1286 233
32 3300042654 Ga0466725_064754 Ga0466725_064754_2095_2904 233
33 3300042605 Ga0466716_078621 Ga0466716_078621_10526_11230 234
34 3300042616 Ga0466715_057006 Ga0466715_057006_533_1255 234
35 3300042655 Ga0466727_225870 Ga0466727_225870_467_1258 234
36 3300042605 Ga0466716_320693 Ga0466716_320693_891_1598 235
37 3300042609 Ga0466722_244426 Ga0466722_244426_339_1046 235
38 3300042624 Ga0466735_200050 Ga0466735_200050_2382_3092 236
39 3300042615 Ga0466711_196937 Ga0466711_196937_20773_21486 237
40 3300042624 Ga0466735_154167 Ga0466735_154167_226_939 237
41 3300042593 Ga0466691_098703 Ga0466691_098703_2977_3693 238
42 3300042652 Ga0466708_060683 Ga0466708_060683_14556_15272 238
43 3300042596 Ga0466696_229029 Ga0466696_229029_2871_3590 239
44 3300042601 Ga0466707_320477 Ga0466707_320477_1658_2377 239
45 3300042624 Ga0466735_120177 Ga0466735_120177_360_1079 239
46 2225789004 2227468526 2227910815 240
47 3300042593 Ga0466691_007963 Ga0466691_007963_4762_5484 240
48 3300042602 Ga0466713_072265 Ga0466713_072265_2353_3075 240
49 3300042636 Ga0466703_239733 Ga0466703_239733_23029_23811 240
50 3300000062 IMNBL1DRAFT_c0003741 IMNBL1DRAFT_00037418 241
51 3300042590 Ga0466690_375807 Ga0466690_375807_6486_7211 241
52 3300042596 Ga0466696_074059 Ga0466696_074059_533_1258 241
53 3300042596 Ga0466696_287535 Ga0466696_287535_21215_21940 241
54 3300042599 Ga0466706_012247 Ga0466706_012247_736_1461 241
55 3300042599 Ga0466706_245430 Ga0466706_245430_55584_56309 241
56 3300042602 Ga0466713_082046 Ga0466713_082046_4663_5388 241
57 3300042615 Ga0466711_476288 Ga0466711_476288_3696_4421 241
58 3300042636 Ga0466703_175370 Ga0466703_175370_1513_2238 241
59 3300042648 Ga0466709_405290 Ga0466709_405290_3705_4430 241
60 iso_pr_bacteria 2820762746 2820764095 241
61 3300002509 JGI24699J35502_11134123 JGI24699J35502_1113412314 242
62 3300042592 Ga0466693_278342 Ga0466693_278342_780_1508 242
63 3300042600 Ga0466700_304523 Ga0466700_304523_1038_1766 242
64 3300042624 Ga0466735_046855 Ga0466735_046855_6412_7140 242
65 3300042636 Ga0466703_176934 Ga0466703_176934_3106_3864 242
66 3300042636 Ga0466703_233451 Ga0466703_233451_424_1152 242
67 3300042652 Ga0466708_014247 Ga0466708_014247_15539_16267 242
68 3300042659 Ga0466733_096868 Ga0466733_096868_48369_49097 242
69 3300000062 IMNBL1DRAFT_c0000298 IMNBL1DRAFT_000029827 243
70 3300042615 Ga0466711_220936 Ga0466711_220936_3963_4694 243
71 3300042619 Ga0466726_231922 Ga0466726_231922_1230_1961 243
72 3300005071 Ga0068302_10041915 Ga0068302_100419153 244
73 3300042600 Ga0466700_461092 Ga0466700_461092_47_781 244
74 3300042613 Ga0466710_436274 Ga0466710_436274_2196_2948 244
75 3300042616 Ga0466715_063927 Ga0466715_063927_8296_9030 244
76 3300042624 Ga0466735_013515 Ga0466735_013515_2361_3095 244
77 3300042624 Ga0466735_149918 Ga0466735_149918_1430_2164 244
78 3300042643 Ga0466704_532198 Ga0466704_532198_775_1509 244
79 3300000062 IMNBL1DRAFT_c0008449 IMNBL1DRAFT_00084495 245
80 3300002462 JGI24702J35022_10044568 JGI24702J35022_100445684 245
81 3300042599 Ga0466706_259930 Ga0466706_259930_31_843 245
82 3300042601 Ga0466707_132567 Ga0466707_132567_414_1151 245
83 3300002834 JGI24696J40584_12924354 JGI24696J40584_129243542 246
84 3300010882 Ga0123354_10010789 Ga0123354_100107894 246
85 3300042582 Ga0466657_385427 Ga0466657_385427_1433_2173 246
86 3300042599 Ga0466706_115643 Ga0466706_115643_5374_6114 246
87 3300042602 Ga0466713_028113 Ga0466713_028113_2191_2931 246
88 3300042609 Ga0466722_008321 Ga0466722_008321_4860_5600 246
89 3300042609 Ga0466722_263608 Ga0466722_263608_15551_16291 246
90 3300042611 Ga0466697_258576 Ga0466697_258576_118816_119556 246
91 3300042615 Ga0466711_100420 Ga0466711_100420_8707_9447 246
92 3300042616 Ga0466715_110752 Ga0466715_110752_6350_7090 246
93 3300042616 Ga0466715_193888 Ga0466715_193888_85508_86248 246
94 3300002462 JGI24702J35022_10097548 JGI24702J35022_100975482 247
95 3300042591 Ga0466692_131879 Ga0466692_131879_18185_18928 247
96 3300042591 Ga0466692_202144 Ga0466692_202144_33978_34721 247
97 3300042599 Ga0466706_074761 Ga0466706_074761_32_775 247
98 3300042599 Ga0466706_118269 Ga0466706_118269_1192_1983 247
99 3300042602 Ga0466713_045299 Ga0466713_045299_7725_8468 247
100 3300042606 Ga0466719_065003 Ga0466719_065003_2456_3199 247
101 3300042606 Ga0466719_236394 Ga0466719_236394_146_928 247
102 3300042606 Ga0466719_541364 Ga0466719_541364_1373_2116 247
103 3300042609 Ga0466722_043134 Ga0466722_043134_38690_39433 247
104 iso_pr_bacteria 3004677695 3004678109 247
105 3300002504 JGI24705J35276_12213483 JGI24705J35276_122134833 248
106 3300009784 Ga0123357_10025099 Ga0123357_100250994 248
107 3300042591 Ga0466692_047378 Ga0466692_047378_72147_72893 248
108 3300042591 Ga0466692_048325 Ga0466692_048325_3494_4240 248
109 3300042593 Ga0466691_012716 Ga0466691_012716_13839_14585 248
110 3300042602 Ga0466713_081814 Ga0466713_081814_2647_3393 248
111 3300042605 Ga0466716_340066 Ga0466716_340066_1286_2032 248
112 3300042621 Ga0466729_180265 Ga0466729_180265_4418_5164 248
113 3300042636 Ga0466703_250134 Ga0466703_250134_4781_5527 248
114 3300009784 Ga0123357_10028511 Ga0123357_100285113 249
115 3300010882 Ga0123354_10071882 Ga0123354_100718824 249
116 3300010882 Ga0123354_10333812 Ga0123354_103338122 249
117 3300042593 Ga0466691_022426 Ga0466691_022426_54555_55304 249
118 3300042643 Ga0466704_073764 Ga0466704_073764_49939_50688 249
119 3300042643 Ga0466704_151669 Ga0466704_151669_25_774 249
120 3300042643 Ga0466704_154577 Ga0466704_154577_1740_2489 249
121 3300042652 Ga0466708_185973 Ga0466708_185973_2628_3377 249
122 3300042654 Ga0466725_193589 Ga0466725_193589_1434_2183 249
123 3300042655 Ga0466727_240150 Ga0466727_240150_1592_2341 249
124 3300009784 Ga0123357_10008856 Ga0123357_100088564 250
125 3300024582 Ga0265387_1007104 Ga0265387_10071042 250
126 3300042590 Ga0466690_245129 Ga0466690_245129_12659_13411 250
127 3300042605 Ga0466716_535552 Ga0466716_535552_2960_3712 250
128 3300042612 Ga0466705_112010 Ga0466705_112010_145_936 250
129 3300042613 Ga0466710_117443 Ga0466710_117443_6322_7074 250
130 3300042615 Ga0466711_011264 Ga0466711_011264_2519_3271 250
131 3300042616 Ga0466715_083069 Ga0466715_083069_20132_20884 250
132 3300042616 Ga0466715_624866 Ga0466715_624866_3018_3770 250
133 3300042620 Ga0466728_016383 Ga0466728_016383_32484_33236 250
134 3300042636 Ga0466703_232598 Ga0466703_232598_4936_5688 250
135 3300042643 Ga0466704_116828 Ga0466704_116828_25_777 250
136 2225789003 2227063698 2227419634 251
137 2225789004 2227527402 2228036463 251
138 2225789004 2227532116 2228045008 251
139 3300005083 Ga0068305_10073289 Ga0068305_100732894 251
140 3300042590 Ga0466690_069343 Ga0466690_069343_969_1724 251
141 3300042590 Ga0466690_113175 Ga0466690_113175_5093_5848 251
142 3300042592 Ga0466693_065613 Ga0466693_065613_416_1171 251
143 3300042605 Ga0466716_025507 Ga0466716_025507_52_807 251
144 3300042624 Ga0466735_102645 Ga0466735_102645_15443_16198 251
145 3300042648 Ga0466709_110644 Ga0466709_110644_7050_7805 251
146 3300042659 Ga0466733_030815 Ga0466733_030815_3907_4662 251
147 iso_pr_bacteria 2967483437 2967486665 251
148 3300002504 JGI24705J35276_12238107 JGI24705J35276_1223810714 252
149 3300042550 Ga0466656_187408 Ga0466656_187408_5497_6255 252
150 3300042602 Ga0466713_109063 Ga0466713_109063_6313_7071 252
151 3300042643 Ga0466704_121749 Ga0466704_121749_2502_3260 252
152 iso_pr_bacteria 2830041218 2830043550 252
153 3300042618 Ga0466723_070186 Ga0466723_070186_21314_22075 253
154 3300042636 Ga0466703_148815 Ga0466703_148815_997_1758 253
155 iso_pr_bacteria 2923982719 2923984268 253
156 iso_pr_bacteria 2940199050 2940199529 253
157 iso_pr_bacteria 2940209341 2940210409 253
158 iso_pr_bacteria 2940346213 2940347142 253
159 iso_pr_bacteria 2940371297 2940371943 253
160 3300042599 Ga0466706_255100 Ga0466706_255100_2134_2898 254
161 3300042615 Ga0466711_028440 Ga0466711_028440_14405_15169 254
162 3300002462 JGI24702J35022_10195092 JGI24702J35022_101950922 255
163 3300042615 Ga0466711_083476 Ga0466711_083476_5049_5816 255
164 3300002509 JGI24699J35502_11134227 JGI24699J35502_1113422738 256
165 3300005083 Ga0068305_10037746 Ga0068305_100377469 256
166 3300042618 Ga0466723_047289 Ga0466723_047289_1913_2707 256
167 3300042655 Ga0466727_119767 Ga0466727_119767_36_806 256
168 3300000062 IMNBL1DRAFT_c0004532 IMNBL1DRAFT_00045328 257
169 3300042612 Ga0466705_147814 Ga0466705_147814_102_875 257
170 iso_pr_bacteria 2940195863 2940198925 257
171 iso_pr_bacteria 2940202316 2940204244 257
172 3300042609 Ga0466722_132116 Ga0466722_132116_1150_1965 258
173 3300042659 Ga0466733_213890 Ga0466733_213890_1852_2631 259
174 iso_pr_bacteria 3004672520 3004675978 259
175 3300002462 JGI24702J35022_10054553 JGI24702J35022_100545532 260
176 3300042599 Ga0466706_161606 Ga0466706_161606_1493_2275 260
177 iso_pr_bacteria 2922326829 2922327023 260
178 3300042596 Ga0466696_302479 Ga0466696_302479_51456_52241 261
179 3300042616 Ga0466715_173384 Ga0466715_173384_12218_13006 262
180 3300042590 Ga0466690_149426 Ga0466690_149426_2304_3098 264
181 iso_pr_bacteria 3004667792 3004668519 267
182 3300042593 Ga0466691_082783 Ga0466691_082783_2692_3498 268
183 iso_pr_bacteria 2820757377 2820759707 268
184 3300042599 Ga0466706_197440 Ga0466706_197440_18861_19688 275

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.36 0.61 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.