Protein Family IF05655
Metagenome
Isolate
133
Members
66
Samples
130
Scaffolds
109.48
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_194744|Ga0466706_194744_960_1346
- Length
- 128 aa
- Sequence
- MTAIVNAIRRGDVWLVELDPARGTEANKTRPAIVVSNNGVNNAARASSKGGVVTLVPLTSNTSRIHDFQALIHAGAATGLSVDSKAQCEQLRSVHVGRLVSRLGAISAEELAAVEDALVVQLNLEQAW
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.1%
Formicidae
22.2%
Kalotermitidae
20.6%
Rhinotermitidae
6.3%
Unclassified
4.8%
Termopsidae
4.8%
Aphididae
1.6%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 2 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 11 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 12 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 13 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 21 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 22 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 25 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 26 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 32 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 41 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 48 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 49 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 50 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 53 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 54 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 55 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 56 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 57 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 58 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 59 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 60 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 61 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 62 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 63 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 64 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 65 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 66 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_091653 | 3300042611 | Bacteria | 2204 |
| 2 | AustNasuHG_c1035281 | 3300000089 | Bacteria | 1321 |
| 3 | Ga0103268_1002500 | 3300007192 | Bacteria | 4058 |
| 4 | Ga0466718_017878 | 3300042617 | Bacteria | 3502 |
| 5 | Ga0466718_139622 | 3300042617 | Bacteria | 2328 |
| 6 | Ga0415639_117410 | 3300038395 | Bacteria | 1398 |
| 7 | Ga0466691_067333 | 3300042593 | Bacteria | 1378 |
| 8 | Ga0466694_074868 | 3300042594 | Unclassified | 2133 |
| 9 | Ga0466730_040032 | 3300042625 | Bacteria | 1481 |
| 10 | Ga0466703_203111 | 3300042636 | Bacteria | 3115 |
| 11 | Ga0466704_500052 | 3300042643 | Unclassified | 1660 |
| 12 | Ga0466708_272013 | 3300042652 | Bacteria | 26959 |
| 13 | Ga0466706_139857 | 3300042599 | Bacteria | 1065 |
| 14 | Ga0466722_128130 | 3300042609 | Bacteria | 1074 |
| 15 | Ga0466705_306570 | 3300042612 | Unclassified | 4416 |
| 16 | AustNasuHG_c1008525 | 3300000089 | Bacteria | 3628 |
| 17 | JGI24702J35022_10005922 | 3300002462 | Bacteria | 7104 |
| 18 | JGI24696J40584_12851317 | 3300002834 | Bacteria | 982 |
| 19 | Ga0103263_101497 | 3300007042 | Bacteria | 3013 |
| 20 | Ga0102736_1000002 | 3300007052 | Bacteria | 204958 |
| 21 | Ga0102736_1003365 | 3300007052 | Unclassified | 2343 |
| 22 | Ga0103261_1016455 | 3300007083 | Bacteria | 1033 |
| 23 | Ga0102734_1030427 | 3300007129 | Bacteria | 1388 |
| 24 | Ga0102738_1000333 | 3300007141 | Bacteria | 8549 |
| 25 | Ga0102737_1008962 | 3300007142 | Bacteria | 1741 |
| 26 | Ga0103264_1000620 | 3300007188 | Bacteria | 18965 |
| 27 | Ga0123353_11872203 | 3300010167 | Bacteria | 742 |
| 28 | Ga0466715_376734 | 3300042616 | Bacteria | 8009 |
| 29 | Ga0466723_087914 | 3300042618 | Unclassified | 2038 |
| 30 | Ga0466690_311699 | 3300042590 | Bacteria | 1739 |
| 31 | Ga0466691_185644 | 3300042593 | Bacteria | 13701 |
| 32 | Ga0466704_002081 | 3300042643 | Bacteria | 4841 |
| 33 | Ga0466704_194360 | 3300042643 | Bacteria | 1531 |
| 34 | Ga0466725_042440 | 3300042654 | Bacteria | 10357 |
| 35 | Ga0466701_076043 | 3300042598 | Bacteria | 2128 |
| 36 | Ga0466707_393670 | 3300042601 | Bacteria | 1317 |
| 37 | Ga0466705_180528 | 3300042612 | Bacteria | 7314 |
| 38 | Ga0072940_1011151 | 3300005200 | Bacteria | 2033 |
| 39 | Ga0072940_1235359 | 3300005200 | Bacteria | 619 |
| 40 | Ga0103266_1004311 | 3300007067 | Bacteria | 1930 |
| 41 | Ga0102739_1004605 | 3300007095 | Bacteria | 1933 |
| 42 | Ga0102738_1001991 | 3300007141 | Unclassified | 3087 |
| 43 | Ga0103264_1017958 | 3300007188 | Bacteria | 3841 |
| 44 | Ga0103264_1047748 | 3300007188 | Bacteria | 1713 |
| 45 | Ga0103267_1001302 | 3300007190 | Bacteria | 6170 |
| 46 | Ga0466705_390027 | 3300042612 | Bacteria | 1266 |
| 47 | Ga0466728_286990 | 3300042620 | Bacteria | 1288 |
| 48 | Ga0466695_004959 | 3300042595 | Bacteria | 4172 |
| 49 | Ga0466699_021424 | 3300042597 | Bacteria | 4961 |
| 50 | Ga0466703_424531 | 3300042636 | Bacteria | 1112 |
| 51 | Ga0466727_056130 | 3300042655 | Bacteria | 1987 |
| 52 | Ga0466706_124892 | 3300042599 | Bacteria | 6996 |
| 53 | Ga0466700_301722 | 3300042600 | Bacteria | 1118 |
| 54 | Ga0466717_137923 | 3300042604 | Bacteria | 4360 |
| 55 | Ga0102740_1017238 | 3300007140 | Bacteria | 1104 |
| 56 | Ga0466711_430851 | 3300042615 | Unclassified | 1088 |
| 57 | Ga0466726_313204 | 3300042619 | Bacteria | 1836 |
| 58 | Ga0466691_053792 | 3300042593 | Bacteria | 3009 |
| 59 | Ga0466734_024673 | 3300042623 | Bacteria | 19892 |
| 60 | Ga0466730_050946 | 3300042625 | Bacteria | 1375 |
| 61 | Ga0466725_096584 | 3300042654 | Bacteria | 13766 |
| 62 | Ga0466725_458502 | 3300042654 | Bacteria | 1515 |
| 63 | Ga0466701_068962 | 3300042598 | Bacteria | 4109 |
| 64 | Ga0466707_381586 | 3300042601 | Bacteria | 1505 |
| 65 | Ga0466720_189192 | 3300042607 | Bacteria | 1623 |
| 66 | Ga0466697_156757 | 3300042611 | Unclassified | 4917 |
| 67 | Ga0466733_081189 | 3300042659 | Bacteria | 44156 |
| 68 | Ga0103266_1001143 | 3300007067 | Bacteria | 4690 |
| 69 | Ga0103261_1016049 | 3300007083 | Bacteria | 1045 |
| 70 | Ga0102737_1004714 | 3300007142 | Unclassified | 2847 |
| 71 | Ga0123356_11171954 | 3300010049 | Bacteria | 935 |
| 72 | Ga0123356_11323245 | 3300010049 | Bacteria | 883 |
| 73 | Ga0466711_072706 | 3300042615 | Bacteria | 10504 |
| 74 | Ga0466711_217655 | 3300042615 | Bacteria | 6012 |
| 75 | Ga0466711_427003 | 3300042615 | Bacteria | 18984 |
| 76 | Ga0466715_051527 | 3300042616 | Bacteria | 18821 |
| 77 | Ga0466726_003622 | 3300042619 | Bacteria | 5797 |
| 78 | Ga0466729_104498 | 3300042621 | Bacteria | 1014 |
| 79 | Ga0466693_374218 | 3300042592 | Bacteria | 1008 |
| 80 | Ga0466691_076991 | 3300042593 | Bacteria | 2624 |
| 81 | Ga0466731_375908 | 3300042622 | Bacteria | 1061 |
| 82 | Ga0466727_288311 | 3300042655 | Bacteria | 1251 |
| 83 | Ga0466700_347518 | 3300042600 | Bacteria | 4247 |
| 84 | Ga0466719_279800 | 3300042606 | Bacteria | 3349 |
| 85 | Ga0466722_149732 | 3300042609 | Bacteria | 1318 |
| 86 | Ga0072941_1000909 | 3300005201 | Bacteria | 19089 |
| 87 | Ga0102736_1000012 | 3300007052 | Bacteria | 90806 |
| 88 | Ga0103261_1001722 | 3300007083 | Bacteria | 5423 |
| 89 | Ga0102739_1033030 | 3300007095 | Bacteria | 693 |
| 90 | Ga0102737_1003003 | 3300007142 | Bacteria | 4001 |
| 91 | Ga0466657_120948 | 3300042582 | Bacteria | 1316 |
| 92 | Ga0466657_291406 | 3300042582 | Bacteria | 13330 |
| 93 | Ga0466696_011161 | 3300042596 | Bacteria | 29798 |
| 94 | Ga0466701_008040 | 3300042598 | Unclassified | 1305 |
| 95 | Ga0466734_018828 | 3300042623 | Bacteria | 1430 |
| 96 | Ga0466704_277147 | 3300042643 | Bacteria | 1894 |
| 97 | Ga0466708_167997 | 3300042652 | Bacteria | 7768 |
| 98 | Ga0466706_194744 | 3300042599 | Bacteria | 1502 |
| 99 | Ga0466716_154349 | 3300042605 | Bacteria | 7985 |
| 100 | Ga0466697_033765 | 3300042611 | Bacteria | 2665 |
| 101 | FAAS_10007680 | 3300001880 | Unclassified | 887 |
| 102 | JGI24695J34938_10099475 | 3300002450 | Bacteria | 1189 |
| 103 | Ga0103260_1088873 | 3300007139 | Bacteria | 510 |
| 104 | Ga0466711_170967 | 3300042615 | Unclassified | 1464 |
| 105 | Ga0466715_298901 | 3300042616 | Bacteria | 3259 |
| 106 | Ga0466715_451170 | 3300042616 | Bacteria | 2387 |
| 107 | Ga0264413_114166 | 3300024493 | Bacteria | 2462 |
| 108 | Ga0466691_046757 | 3300042593 | Unclassified | 1919 |
| 109 | Ga0466704_316523 | 3300042643 | Bacteria | 1994 |
| 110 | Ga0466708_162955 | 3300042652 | Bacteria | 2958 |
| 111 | Ga0466707_153212 | 3300042601 | Bacteria | 1184 |
| 112 | Ga0466717_274192 | 3300042604 | Bacteria | 2150 |
| 113 | Ga0466697_028812 | 3300042611 | Bacteria | 7813 |
| 114 | Ga0466697_041293 | 3300042611 | Bacteria | 5643 |
| 115 | JGI24702J35022_10275135 | 3300002462 | Bacteria | 986 |
| 116 | JGI24702J35022_10780477 | 3300002462 | Bacteria | 595 |
| 117 | Ga0103266_1008386 | 3300007067 | Bacteria | 1249 |
| 118 | Ga0103265_1001760 | 3300007068 | Unclassified | 3450 |
| 119 | Ga0102739_1004503 | 3300007095 | Bacteria | 1964 |
| 120 | Ga0103267_1033727 | 3300007190 | Bacteria | 1709 |
| 121 | Ga0123356_10627032 | 3300010049 | Bacteria | 1241 |
| 122 | Ga0466711_121226 | 3300042615 | Bacteria | 40224 |
| 123 | Ga0466711_230778 | 3300042615 | Bacteria | 1055 |
| 124 | Ga0456237_0012647 | 3300041968 | Bacteria | 1220 |
| 125 | Ga0466692_078946 | 3300042591 | Unclassified | 1967 |
| 126 | Ga0466735_039620 | 3300042624 | Bacteria | 1298 |
| 127 | Ga0466704_095063 | 3300042643 | Bacteria | 5611 |
| 128 | Ga0466706_054579 | 3300042599 | Bacteria | 4651 |
| 129 | Ga0466707_179326 | 3300042601 | Bacteria | 1057 |
| 130 | Ga0466722_264198 | 3300042609 | Bacteria | 1023 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042593 | Ga0466691_046757 | Ga0466691_046757_1290_1553 | 87 |
| 2 | 3300042596 | Ga0466696_011161 | Ga0466696_011161_6961_7248 | 95 |
| 3 | 3300042623 | Ga0466734_024673 | Ga0466734_024673_14882_15217 | 101 |
| 4 | 3300042618 | Ga0466723_087914 | Ga0466723_087914_1447_1764 | 105 |
| 5 | 3300024493 | Ga0264413_114166 | Ga0264413_1141665 | 106 |
| 6 | 3300042590 | Ga0466690_311699 | Ga0466690_311699_1376_1696 | 106 |
| 7 | 3300042593 | Ga0466691_067333 | Ga0466691_067333_760_1080 | 106 |
| 8 | 3300042599 | Ga0466706_139857 | Ga0466706_139857_373_693 | 106 |
| 9 | 3300042601 | Ga0466707_179326 | Ga0466707_179326_533_853 | 106 |
| 10 | 3300042615 | Ga0466711_217655 | Ga0466711_217655_1858_2178 | 106 |
| 11 | 3300042625 | Ga0466730_040032 | Ga0466730_040032_159_479 | 106 |
| 12 | 3300042625 | Ga0466730_050946 | Ga0466730_050946_467_787 | 106 |
| 13 | 3300042643 | Ga0466704_095063 | Ga0466704_095063_2410_2730 | 106 |
| 14 | 3300042655 | Ga0466727_288311 | Ga0466727_288311_316_636 | 106 |
| 15 | 3300000089 | AustNasuHG_c1008525 | AustNasuHG_10085251 | 107 |
| 16 | 3300005201 | Ga0072941_1000909 | Ga0072941_10009099 | 107 |
| 17 | 3300007067 | Ga0103266_1004311 | Ga0103266_10043113 | 107 |
| 18 | 3300007067 | Ga0103266_1008386 | Ga0103266_10083861 | 107 |
| 19 | 3300007129 | Ga0102734_1030427 | Ga0102734_10304274 | 107 |
| 20 | 3300007139 | Ga0103260_1088873 | Ga0103260_10888732 | 107 |
| 21 | 3300007140 | Ga0102740_1017238 | Ga0102740_10172383 | 107 |
| 22 | 3300007141 | Ga0102738_1000333 | Ga0102738_10003335 | 107 |
| 23 | 3300007190 | Ga0103267_1001302 | Ga0103267_10013025 | 107 |
| 24 | 3300010049 | Ga0123356_11323245 | Ga0123356_113232452 | 107 |
| 25 | 3300042597 | Ga0466699_021424 | Ga0466699_021424_3968_4291 | 107 |
| 26 | 3300042607 | Ga0466720_189192 | Ga0466720_189192_164_487 | 107 |
| 27 | 3300042615 | Ga0466711_230778 | Ga0466711_230778_260_583 | 107 |
| 28 | 3300042617 | Ga0466718_017878 | Ga0466718_017878_1261_1584 | 107 |
| 29 | 3300042621 | Ga0466729_104498 | Ga0466729_104498_397_720 | 107 |
| 30 | 3300042643 | Ga0466704_194360 | Ga0466704_194360_487_810 | 107 |
| 31 | 3300002450 | JGI24695J34938_10099475 | JGI24695J34938_100994753 | 108 |
| 32 | 3300005200 | Ga0072940_1235359 | Ga0072940_12353592 | 108 |
| 33 | 3300010049 | Ga0123356_11171954 | Ga0123356_111719542 | 108 |
| 34 | 3300038395 | Ga0415639_117410 | Ga0415639_117410_996_1322 | 108 |
| 35 | 3300041968 | Ga0456237_0012647 | Ga0456237_0012647_539_865 | 108 |
| 36 | 3300042582 | Ga0466657_120948 | Ga0466657_120948_379_705 | 108 |
| 37 | 3300042582 | Ga0466657_291406 | Ga0466657_291406_4731_5057 | 108 |
| 38 | 3300042591 | Ga0466692_078946 | Ga0466692_078946_700_1026 | 108 |
| 39 | 3300042593 | Ga0466691_076991 | Ga0466691_076991_267_593 | 108 |
| 40 | 3300042595 | Ga0466695_004959 | Ga0466695_004959_921_1247 | 108 |
| 41 | 3300042598 | Ga0466701_008040 | Ga0466701_008040_666_992 | 108 |
| 42 | 3300042598 | Ga0466701_076043 | Ga0466701_076043_506_832 | 108 |
| 43 | 3300042599 | Ga0466706_124892 | Ga0466706_124892_3430_3756 | 108 |
| 44 | 3300042601 | Ga0466707_393670 | Ga0466707_393670_721_1047 | 108 |
| 45 | 3300042604 | Ga0466717_137923 | Ga0466717_137923_3647_3973 | 108 |
| 46 | 3300042605 | Ga0466716_154349 | Ga0466716_154349_747_1073 | 108 |
| 47 | 3300042606 | Ga0466719_279800 | Ga0466719_279800_2698_3024 | 108 |
| 48 | 3300042609 | Ga0466722_128130 | Ga0466722_128130_579_905 | 108 |
| 49 | 3300042609 | Ga0466722_149732 | Ga0466722_149732_416_742 | 108 |
| 50 | 3300042611 | Ga0466697_028812 | Ga0466697_028812_607_933 | 108 |
| 51 | 3300042611 | Ga0466697_033765 | Ga0466697_033765_17_343 | 108 |
| 52 | 3300042611 | Ga0466697_041293 | Ga0466697_041293_1148_1474 | 108 |
| 53 | 3300042612 | Ga0466705_180528 | Ga0466705_180528_2438_2764 | 108 |
| 54 | 3300042612 | Ga0466705_306570 | Ga0466705_306570_1487_1813 | 108 |
| 55 | 3300042615 | Ga0466711_072706 | Ga0466711_072706_3501_3827 | 108 |
| 56 | 3300042615 | Ga0466711_121226 | Ga0466711_121226_34395_34721 | 108 |
| 57 | 3300042615 | Ga0466711_170967 | Ga0466711_170967_308_634 | 108 |
| 58 | 3300042615 | Ga0466711_427003 | Ga0466711_427003_18324_18650 | 108 |
| 59 | 3300042615 | Ga0466711_430851 | Ga0466711_430851_651_977 | 108 |
| 60 | 3300042616 | Ga0466715_051527 | Ga0466715_051527_16552_16878 | 108 |
| 61 | 3300042616 | Ga0466715_298901 | Ga0466715_298901_459_785 | 108 |
| 62 | 3300042616 | Ga0466715_451170 | Ga0466715_451170_1115_1441 | 108 |
| 63 | 3300042617 | Ga0466718_139622 | Ga0466718_139622_1581_1907 | 108 |
| 64 | 3300042619 | Ga0466726_003622 | Ga0466726_003622_5012_5338 | 108 |
| 65 | 3300042619 | Ga0466726_313204 | Ga0466726_313204_447_773 | 108 |
| 66 | 3300042620 | Ga0466728_286990 | Ga0466728_286990_237_563 | 108 |
| 67 | 3300042636 | Ga0466703_424531 | Ga0466703_424531_561_887 | 108 |
| 68 | 3300042643 | Ga0466704_277147 | Ga0466704_277147_1128_1454 | 108 |
| 69 | 3300042643 | Ga0466704_316523 | Ga0466704_316523_656_982 | 108 |
| 70 | 3300042643 | Ga0466704_500052 | Ga0466704_500052_382_708 | 108 |
| 71 | 3300042652 | Ga0466708_162955 | Ga0466708_162955_754_1080 | 108 |
| 72 | 3300042652 | Ga0466708_167997 | Ga0466708_167997_277_603 | 108 |
| 73 | 3300042654 | Ga0466725_042440 | Ga0466725_042440_3500_3826 | 108 |
| 74 | 3300042654 | Ga0466725_458502 | Ga0466725_458502_612_938 | 108 |
| 75 | 3300042655 | Ga0466727_056130 | Ga0466727_056130_1271_1597 | 108 |
| 76 | 3300042659 | Ga0466733_081189 | Ga0466733_081189_19434_19760 | 108 |
| 77 | iso_pr_bacteria | 2820005795 | 2820007635 | 108 |
| 78 | iso_pr_bacteria | 2820050117 | 2820052230 | 108 |
| 79 | iso_pr_bacteria | 648861007 | 648922263 | 108 |
| 80 | 3300002462 | JGI24702J35022_10005922 | JGI24702J35022_100059225 | 109 |
| 81 | 3300002462 | JGI24702J35022_10275135 | JGI24702J35022_102751351 | 109 |
| 82 | 3300002462 | JGI24702J35022_10780477 | JGI24702J35022_107804771 | 109 |
| 83 | 3300007042 | Ga0103263_101497 | Ga0103263_1014973 | 109 |
| 84 | 3300007052 | Ga0102736_1000002 | Ga0102736_10000028 | 109 |
| 85 | 3300007052 | Ga0102736_1000012 | Ga0102736_100001267 | 109 |
| 86 | 3300007052 | Ga0102736_1003365 | Ga0102736_10033653 | 109 |
| 87 | 3300007067 | Ga0103266_1001143 | Ga0103266_10011433 | 109 |
| 88 | 3300007068 | Ga0103265_1001760 | Ga0103265_10017606 | 109 |
| 89 | 3300007083 | Ga0103261_1001722 | Ga0103261_10017224 | 109 |
| 90 | 3300007083 | Ga0103261_1016049 | Ga0103261_10160491 | 109 |
| 91 | 3300007083 | Ga0103261_1016455 | Ga0103261_10164553 | 109 |
| 92 | 3300007095 | Ga0102739_1004503 | Ga0102739_10045033 | 109 |
| 93 | 3300007095 | Ga0102739_1004605 | Ga0102739_10046054 | 109 |
| 94 | 3300007095 | Ga0102739_1033030 | Ga0102739_10330302 | 109 |
| 95 | 3300007141 | Ga0102738_1001991 | Ga0102738_10019916 | 109 |
| 96 | 3300007142 | Ga0102737_1003003 | Ga0102737_10030034 | 109 |
| 97 | 3300007142 | Ga0102737_1004714 | Ga0102737_10047146 | 109 |
| 98 | 3300007142 | Ga0102737_1008962 | Ga0102737_10089623 | 109 |
| 99 | 3300007188 | Ga0103264_1000620 | Ga0103264_100062018 | 109 |
| 100 | 3300007188 | Ga0103264_1017958 | Ga0103264_10179586 | 109 |
| 101 | 3300007188 | Ga0103264_1047748 | Ga0103264_10477482 | 109 |
| 102 | 3300007190 | Ga0103267_1033727 | Ga0103267_10337273 | 109 |
| 103 | 3300007192 | Ga0103268_1002500 | Ga0103268_10025005 | 109 |
| 104 | 3300010049 | Ga0123356_10627032 | Ga0123356_106270323 | 109 |
| 105 | 3300042601 | Ga0466707_381586 | Ga0466707_381586_960_1292 | 110 |
| 106 | 3300042654 | Ga0466725_096584 | Ga0466725_096584_13187_13522 | 111 |
| 107 | 3300042612 | Ga0466705_390027 | Ga0466705_390027_459_800 | 113 |
| 108 | 3300042643 | Ga0466704_002081 | Ga0466704_002081_1056_1397 | 113 |
| 109 | 3300042609 | Ga0466722_264198 | Ga0466722_264198_378_722 | 114 |
| 110 | 3300001880 | FAAS_10007680 | FAAS_100076802 | 115 |
| 111 | 3300005200 | Ga0072940_1011151 | Ga0072940_10111513 | 115 |
| 112 | 3300042592 | Ga0466693_374218 | Ga0466693_374218_72_419 | 115 |
| 113 | 3300042593 | Ga0466691_053792 | Ga0466691_053792_346_693 | 115 |
| 114 | 3300042594 | Ga0466694_074868 | Ga0466694_074868_1118_1465 | 115 |
| 115 | 3300042600 | Ga0466700_301722 | Ga0466700_301722_270_617 | 115 |
| 116 | 3300042600 | Ga0466700_347518 | Ga0466700_347518_1681_2028 | 115 |
| 117 | 3300042601 | Ga0466707_153212 | Ga0466707_153212_131_478 | 115 |
| 118 | 3300042611 | Ga0466697_091653 | Ga0466697_091653_881_1228 | 115 |
| 119 | 3300042611 | Ga0466697_156757 | Ga0466697_156757_2907_3254 | 115 |
| 120 | 3300042616 | Ga0466715_376734 | Ga0466715_376734_3698_4045 | 115 |
| 121 | 3300042624 | Ga0466735_039620 | Ga0466735_039620_169_516 | 115 |
| 122 | 3300042636 | Ga0466703_203111 | Ga0466703_203111_619_966 | 115 |
| 123 | 3300042652 | Ga0466708_272013 | Ga0466708_272013_20909_21256 | 115 |
| 124 | 3300002834 | JGI24696J40584_12851317 | JGI24696J40584_128513173 | 116 |
| 125 | 3300042593 | Ga0466691_185644 | Ga0466691_185644_5241_5591 | 116 |
| 126 | 3300000089 | AustNasuHG_c1035281 | AustNasuHG_10352813 | 117 |
| 127 | 3300010167 | Ga0123353_11872203 | Ga0123353_118722031 | 117 |
| 128 | 3300042598 | Ga0466701_068962 | Ga0466701_068962_681_1034 | 117 |
| 129 | 3300042599 | Ga0466706_054579 | Ga0466706_054579_595_957 | 120 |
| 130 | 3300042623 | Ga0466734_018828 | Ga0466734_018828_812_1174 | 120 |
| 131 | 3300042622 | Ga0466731_375908 | Ga0466731_375908_134_514 | 126 |
| 132 | 3300042599 | Ga0466706_194744 | Ga0466706_194744_960_1346 | 128 |
| 133 | 3300042604 | Ga0466717_274192 | Ga0466717_274192_280_690 | 136 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02452 | PemK_toxin | PemK-like, MazF-like toxin of type II toxin-antitoxin system | 9 | 120 | 0.9 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02452 | GO:0003677 | DNA binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.