Protein Family IF05644

Metagenome Isolate
147 Members
88 Samples
114 Scaffolds
227.73 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_174997|Ga0466706_174997_4803_5624
Length
262 aa
Sequence
VLFYFHQRLFHFNEIKECFKISYFCNLKNNKISMKFGVVIFPGSNCDHDMIYLLETLLGQQVVQLWHKDTDLQNCDMVVLPGGFSYGDYLRSGAIARLSPIMASVIDFAQRGGYVLGVCNGFQILCESHLLSGALLANNNQKFVCKNQYLTPQTNNTIFTKDAVVGKPLNIPIAHGEGRFFADAATIKHLNDKDLVLFRYCNEYGDITEEANPNGSIENIAGITNESRNVFGMMPHPERCGDSELSNTDGLVLFNSILKNIR

📊 Sample Types

Isolate 22.4%
Metagenome 77.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 19.8%
Unclassified 16.3%
Kalotermitidae 16.3%
Apidae 11.6%
Armadillidiidae 8.1%
Drosophilidae 3.5%
Elmidae 3.5%
Passalidae 3.5%
Formicidae 3.5%
Culicidae 3.5%
Termopsidae 3.5%
Rhinotermitidae 1.2%
Nephropidae 1.2%
Hodotermitidae 1.2%
Nymphalidae 1.2%
Ixodidae 1.2%
Daphniidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2513237339 Commensalibacter intestini A911 Isolate Drosophilidae
2 2595698199 Melissococcus plutonius 60 Isolate Apidae
3 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
4 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
5 2864951976 Brevundimonas bullata S00223 Isolate Elmidae
6 2891591111 Commensalibacter sp. ESL0382 Isolate Unclassified
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2595698193 Melissococcus plutonius B5 Isolate Apidae
15 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
16 2627854132 Campylobacter peloridis LMG 23910 Isolate Unclassified
17 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
22 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
23 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
30 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
31 2595698197 Melissococcus plutonius H6 Isolate Apidae
32 2775507278 Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 Isolate Nymphalidae
33 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
34 2599185121 Rickettsiales bacterium Ac37b Isolate Ixodidae
35 2916858470 Heyndrickxia oleronia Isolate Unclassified
36 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
37 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
38 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
39 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
43 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
44 2595698195 Melissococcus plutonius 119 Isolate Apidae
45 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
46 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
47 2835008077 Commensalibacter intestini DmL_052 Isolate Drosophilidae
48 2870004507 Campylobacter coli 14983A Isolate Unclassified
49 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
50 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
51 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
52 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
53 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
54 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
55 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
56 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
57 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
58 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
59 2627853628 Melissococcus plutonius 82 Isolate Apidae
60 2864866972 Brevundimonas bullata S00123 Isolate Elmidae
61 8064008355 Heyndrickxia oleronia Isolate Unclassified
62 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
63 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
64 2595698198 Melissococcus plutonius L9 Isolate Apidae
65 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
66 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
67 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
68 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
71 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
72 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
73 2864934081 Brevundimonas vesicularis S00192 Isolate Elmidae
74 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
75 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
76 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
77 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
78 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
79 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
80 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
81 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
82 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
83 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
84 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
85 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
86 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
87 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
88 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10262536 3300009784 Bacteria 1822
2 Ga0123356_10031511 3300010049 Bacteria 4961
3 Ga0123356_10196983 3300010049 Bacteria 2051
4 Ga0466735_000465 3300042624 Bacteria 1196
5 Ga0466703_222314 3300042636 Bacteria 15216
6 Ga0160433_100005 3300012846 Bacteria 450229
7 Ga0466691_134522 3300042593 Bacteria 1432
8 Ga0466711_301869 3300042615 Bacteria 6206
9 Ga0466723_071051 3300042618 Bacteria 19074
10 Ga0466723_217730 3300042618 Bacteria 27182
11 Ga0466728_105347 3300042620 Bacteria 39540
12 Ga0466697_126185 3300042611 Bacteria 21012
13 Ga0103267_1000020 3300007190 Bacteria 55669
14 Ga0105524_106426 3300007733 Bacteria 2885
15 Ga0123353_10020550 3300010167 Bacteria 9870
16 Ga0466735_025506 3300042624 Bacteria 53656
17 Ga0466735_188476 3300042624 Bacteria 1217
18 Ga0466703_226469 3300042636 Bacteria 2317
19 Ga0466704_614948 3300042643 Bacteria 1972
20 Ga0160445_116342 3300012847 Unclassified 1019
21 Ga0160443_100042 3300012848 Bacteria 306108
22 Ga0160448_120157 3300012854 Bacteria 1095
23 Ga0466690_304622 3300042590 Bacteria 2324
24 Ga0466711_347073 3300042615 Bacteria 35232
25 Ga0466723_039304 3300042618 Bacteria 36419
26 Ga0466705_026037 3300042612 Bacteria 6908
27 Ga0466705_314581 3300042612 Bacteria 23813
28 2227080785 2225789004 Bacteria 144818
29 IMNBGM34_c001239 3300000036 Bacteria 4698
30 JGI24695J34938_10011739 3300002450 Unclassified 4700
31 JGI24702J35022_10003396 3300002462 Bacteria 9605
32 Ga0123355_10032679 3300009826 Bacteria 8446
33 Ga0123355_10880007 3300009826 Bacteria 978
34 Ga0466706_195930 3300042599 Bacteria 86451
35 Ga0466707_084781 3300042601 Bacteria 3090
36 Ga0466713_008847 3300042602 Bacteria 37006
37 Ga0466716_308099 3300042605 Bacteria 1992
38 Ga0466704_322863 3300042643 Bacteria 1617
39 Ga0466709_314545 3300042648 Bacteria 211401
40 Ga0160469_102290 3300012824 Bacteria 3719
41 Ga0160467_106095 3300012829 Bacteria 1428
42 Ga0160436_1000001 3300012861 Bacteria 774985
43 Ga0466690_081545 3300042590 Bacteria 5439
44 Ga0466696_100327 3300042596 Bacteria 29738
45 Ga0466715_181995 3300042616 Bacteria 4926
46 Ga0466723_104511 3300042618 Bacteria 2099
47 Ga0466723_279912 3300042618 Bacteria 33283
48 Ga0466728_262266 3300042620 Bacteria 8432
49 2227571567 2225789004 Bacteria 2608
50 Ga0072941_1216076 3300005201 Bacteria 2009
51 Ga0123357_10114309 3300009784 Bacteria 3427
52 Ga0466706_174997 3300042599 Bacteria 89065
53 Ga0466719_205092 3300042606 Bacteria 1087
54 Ga0466708_187729 3300042652 Bacteria 24305
55 Ga0160456_100026 3300012820 Bacteria 249592
56 Ga0160457_1001176 3300012858 Bacteria 7972
57 Ga0466657_164306 3300042582 Bacteria 73166
58 Ga0466696_017168 3300042596 Bacteria 5133
59 Ga0466711_366197 3300042615 Bacteria 6867
60 Ga0466723_313236 3300042618 Bacteria 4478
61 Ga0466705_191288 3300042612 Bacteria 1358
62 Ga0123355_10057375 3300009826 Bacteria 6301
63 Ga0466709_371632 3300042648 Bacteria 1788
64 Ga0466708_010657 3300042652 Bacteria 29621
65 Ga0466708_278416 3300042652 Bacteria 17679
66 Ga0160469_103142 3300012824 Bacteria 2467
67 Ga0466693_031747 3300042592 Bacteria 1108
68 Ga0466693_178382 3300042592 Bacteria 1862
69 Ga0466693_358200 3300042592 Unclassified 2398
70 Ga0466696_423255 3300042596 Bacteria 15260
71 Ga0466712_091685 3300042614 Bacteria 2120
72 Ga0466715_207784 3300042616 Bacteria 15692
73 Ga0466723_005697 3300042618 Bacteria 4602
74 Ga0466723_297854 3300042618 Bacteria 1965
75 IMNBL1DRAFT_c0038469 3300000062 Bacteria 1644
76 JGI24695J34938_10093355 3300002450 Unclassified 1233
77 Ga0123355_10612411 3300009826 Bacteria 1287
78 Ga0466702_063709 3300042635 Bacteria 1247
79 Ga0466727_033939 3300042655 Bacteria 23538
80 Ga0466691_032531 3300042593 Bacteria 7101
81 Ga0466696_148382 3300042596 Bacteria 8478
82 Ga0466726_393916 3300042619 Bacteria 1714
83 Ga0466726_416303 3300042619 Bacteria 3126
84 Ga0466729_164200 3300042621 Bacteria 4097
85 Ga0466697_204917 3300042611 Bacteria 1152
86 JGI24696J40584_12953946 3300002834 Bacteria 2559
87 Ga0074278_115057 3300005721 Bacteria 33992
88 Ga0103267_1000422 3300007190 Bacteria 13589
89 Ga0103268_1000172 3300007192 Bacteria 21394
90 Ga0123353_10545223 3300010167 Bacteria 1675
91 Ga0466701_020243 3300042598 Bacteria 48765
92 Ga0466713_050689 3300042602 Bacteria 16429
93 Ga0160460_100002 3300012845 Bacteria 833437
94 Ga0466693_129195 3300042592 Bacteria 1567
95 Ga0466691_030891 3300042593 Bacteria 7201
96 Ga0466691_066163 3300042593 Bacteria 3699
97 Ga0466691_188565 3300042593 Bacteria 8128
98 Ga0466715_029927 3300042616 Bacteria 12382
99 Ga0466718_069090 3300042617 Bacteria 24251
100 Ga0466726_347789 3300042619 Bacteria 126502
101 Ga0466726_425336 3300042619 Bacteria 28796
102 Ga0466728_060223 3300042620 Bacteria 8693
103 JGI24695J34938_10000897 3300002450 Bacteria 27505
104 Ga0123357_10286567 3300009784 Bacteria 1690
105 Ga0123356_10514042 3300010049 Bacteria 1355
106 Ga0466706_185400 3300042599 Bacteria 21442
107 Ga0466734_002275 3300042623 Bacteria 1001
108 Ga0466704_300405 3300042643 Bacteria 21701
109 Ga0466708_378237 3300042652 Bacteria 28650
110 Ga0160457_1021603 3300012858 Bacteria 900
111 Ga0466691_004347 3300042593 Bacteria 2398
112 Ga0466699_041148 3300042597 Bacteria 1753
113 Ga0466711_138699 3300042615 Bacteria 27213
114 Ga0466723_028077 3300042618 Bacteria 9409

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10262536 Ga0123357_102625362 207
2 3300009826 Ga0123355_10032679 Ga0123355_100326799 209
3 3300012824 Ga0160469_103142 Ga0160469_1031422 210
4 3300012858 Ga0160457_1001176 Ga0160457_10011768 210
5 3300042590 Ga0466690_081545 Ga0466690_081545_3733_4371 212
6 3300042643 Ga0466704_300405 Ga0466704_300405_6225_6863 212
7 iso_pr_bacteria 2767802234 2769328793 212
8 3300042593 Ga0466691_004347 Ga0466691_004347_1290_1931 213
9 3300042596 Ga0466696_148382 Ga0466696_148382_1809_2450 213
10 3300042596 Ga0466696_423255 Ga0466696_423255_2295_2936 213
11 3300042611 Ga0466697_126185 Ga0466697_126185_721_1362 213
12 3300042612 Ga0466705_026037 Ga0466705_026037_827_1468 213
13 3300042615 Ga0466711_347073 Ga0466711_347073_5286_5927 213
14 3300042618 Ga0466723_279912 Ga0466723_279912_26969_27610 213
15 iso_pr_bacteria 2870004507 2870005935 214
16 3300005201 Ga0072941_1216076 Ga0072941_12160762 215
17 3300042599 Ga0466706_195930 Ga0466706_195930_3575_4222 215
18 3300042611 Ga0466697_204917 Ga0466697_204917_119_817 215
19 iso_pr_bacteria 2627854132 2630357904 215
20 3300042592 Ga0466693_129195 Ga0466693_129195_241_903 220
21 iso_pr_bacteria 2864866972 2864869298 220
22 iso_pr_bacteria 2864934081 2864935898 220
23 iso_pr_bacteria 2864951976 2864953879 220
24 3300009826 Ga0123355_10057375 Ga0123355_100573755 221
25 3300012820 Ga0160456_100026 Ga0160456_10002634 221
26 3300012824 Ga0160469_102290 Ga0160469_1022902 221
27 3300012846 Ga0160433_100005 Ga0160433_100005398 221
28 3300012847 Ga0160445_116342 Ga0160445_1163422 221
29 3300012854 Ga0160448_120157 Ga0160448_1201571 221
30 3300012861 Ga0160436_1000001 Ga0160436_1000001630 221
31 3300042619 Ga0466726_425336 Ga0466726_425336_5372_6037 221
32 iso_pr_bacteria 2619619079 2620605518 221
33 iso_pr_bacteria 2820673891 2820675614 221
34 iso_pr_bacteria 2820685979 2820688046 221
35 3300002450 JGI24695J34938_10000897 JGI24695J34938_1000089716 222
36 3300042602 Ga0466713_050689 Ga0466713_050689_11586_12254 222
37 iso_pr_bacteria 2820398208 2820399239 222
38 iso_pr_bacteria 2835143510 2835144592 222
39 3300009826 Ga0123355_10880007 Ga0123355_108800071 223
40 3300042592 Ga0466693_178382 Ga0466693_178382_693_1364 223
41 3300007733 Ga0105524_106426 Ga0105524_1064262 224
42 3300009826 Ga0123355_10612411 Ga0123355_106124112 224
43 3300010167 Ga0123353_10545223 Ga0123353_105452233 224
44 3300042592 Ga0466693_031747 Ga0466693_031747_195_869 224
45 3300042592 Ga0466693_358200 Ga0466693_358200_916_1590 224
46 iso_pr_bacteria 2820607737 2820609724 224
47 3300002450 JGI24695J34938_10011739 JGI24695J34938_100117394 225
48 3300002450 JGI24695J34938_10093355 JGI24695J34938_100933552 225
49 3300002834 JGI24696J40584_12953946 JGI24696J40584_129539462 225
50 3300042618 Ga0466723_104511 Ga0466723_104511_30_707 225
51 3300042636 Ga0466703_226469 Ga0466703_226469_206_904 226
52 3300009784 Ga0123357_10114309 Ga0123357_101143091 227
53 3300042605 Ga0466716_308099 Ga0466716_308099_953_1672 227
54 3300042618 Ga0466723_005697 Ga0466723_005697_3255_3938 227
55 3300042623 Ga0466734_002275 Ga0466734_002275_76_759 227
56 iso_pr_bacteria 2916858470 2916859833 227
57 iso_pr_bacteria 8064008355 8064013452 227
58 3300042582 Ga0466657_164306 Ga0466657_164306_3923_4609 228
59 3300042590 Ga0466690_304622 Ga0466690_304622_1267_1953 228
60 3300042618 Ga0466723_071051 Ga0466723_071051_508_1194 228
61 3300042618 Ga0466723_313236 Ga0466723_313236_952_1671 228
62 3300042620 Ga0466728_105347 Ga0466728_105347_36015_36701 228
63 3300042624 Ga0466735_000465 Ga0466735_000465_124_810 228
64 3300042624 Ga0466735_188476 Ga0466735_188476_12_698 228
65 3300042652 Ga0466708_187729 Ga0466708_187729_14594_15280 228
66 iso_pr_bacteria 2595698190 2596206254 228
67 iso_pr_bacteria 2595698193 2596211665 228
68 iso_pr_bacteria 2595698194 2596213387 228
69 iso_pr_bacteria 2595698195 2596215426 228
70 iso_pr_bacteria 2595698196 2596217167 228
71 iso_pr_bacteria 2595698197 2596219004 228
72 iso_pr_bacteria 2595698198 2596220836 228
73 iso_pr_bacteria 2595698199 2596222640 228
74 iso_pr_bacteria 2627853628 2628280967 228
75 iso_pr_bacteria 2890957088 2890959491 228
76 iso_pr_bacteria 650716050 650845571 228
77 3300007190 Ga0103267_1000020 Ga0103267_10000204 229
78 3300042593 Ga0466691_134522 Ga0466691_134522_106_795 229
79 3300042597 Ga0466699_041148 Ga0466699_041148_42_731 229
80 3300042598 Ga0466701_020243 Ga0466701_020243_29635_30324 229
81 3300042599 Ga0466706_185400 Ga0466706_185400_3967_4656 229
82 3300042601 Ga0466707_084781 Ga0466707_084781_1920_2609 229
83 3300042602 Ga0466713_008847 Ga0466713_008847_15732_16421 229
84 3300042606 Ga0466719_205092 Ga0466719_205092_277_966 229
85 3300042615 Ga0466711_301869 Ga0466711_301869_3425_4114 229
86 3300042618 Ga0466723_039304 Ga0466723_039304_15562_16251 229
87 3300042619 Ga0466726_416303 Ga0466726_416303_1098_1787 229
88 3300042621 Ga0466729_164200 Ga0466729_164200_2999_3688 229
89 3300042655 Ga0466727_033939 Ga0466727_033939_18218_18907 229
90 iso_pr_bacteria 2983866074 2983867537 229
91 3300002462 JGI24702J35022_10003396 JGI24702J35022_1000339610 230
92 3300007190 Ga0103267_1000422 Ga0103267_100042210 230
93 3300010049 Ga0123356_10031511 Ga0123356_100315113 230
94 3300010049 Ga0123356_10514042 Ga0123356_105140422 230
95 3300042614 Ga0466712_091685 Ga0466712_091685_1138_1830 230
96 3300042616 Ga0466715_207784 Ga0466715_207784_8973_9665 230
97 3300042624 Ga0466735_025506 Ga0466735_025506_1095_1787 230
98 3300042652 Ga0466708_278416 Ga0466708_278416_1738_2430 230
99 iso_pr_bacteria 2590828803 2592927051 230
100 iso_pr_bacteria 2599185121 2599225102 230
101 2225789004 2227080785 2227453473 231
102 3300000036 IMNBGM34_c001239 IMNBGM34_0012392 231
103 3300009784 Ga0123357_10286567 Ga0123357_102865673 231
104 3300010049 Ga0123356_10196983 Ga0123356_101969834 231
105 3300012848 Ga0160443_100042 Ga0160443_100042173 231
106 3300042617 Ga0466718_069090 Ga0466718_069090_8726_9421 231
107 3300042593 Ga0466691_032531 Ga0466691_032531_5660_6358 232
108 3300042596 Ga0466696_017168 Ga0466696_017168_4306_5004 232
109 3300042615 Ga0466711_138699 Ga0466711_138699_1688_2386 232
110 3300042652 Ga0466708_378237 Ga0466708_378237_9783_10481 232
111 iso_pr_bacteria 2891591111 2891592046 232
112 3300005721 Ga0074278_115057 Ga0074278_1150572 233
113 3300042593 Ga0466691_066163 Ga0466691_066163_1287_1988 233
114 3300042596 Ga0466696_100327 Ga0466696_100327_12895_13596 233
115 3300042635 Ga0466702_063709 Ga0466702_063709_469_1170 233
116 iso_pr_bacteria 2513237339 2514544588 233
117 iso_pr_bacteria 2775507278 2778219824 233
118 iso_pr_bacteria 2835008077 2835008531 233
119 3300012829 Ga0160467_106095 Ga0160467_1060952 234
120 3300042593 Ga0466691_030891 Ga0466691_030891_4004_4708 234
121 3300042612 Ga0466705_314581 Ga0466705_314581_7834_8538 234
122 3300042619 Ga0466726_393916 Ga0466726_393916_700_1404 234
123 3300042643 Ga0466704_322863 Ga0466704_322863_13_717 234
124 iso_pr_bacteria 2820422691 2820423716 234
125 2225789004 2227571567 2228116895 235
126 3300000062 IMNBL1DRAFT_c0038469 IMNBL1DRAFT_00384693 235
127 3300007192 Ga0103268_1000172 Ga0103268_100017214 235
128 3300010167 Ga0123353_10020550 Ga0123353_100205502 235
129 3300042616 Ga0466715_181995 Ga0466715_181995_1956_2666 236
130 3300042619 Ga0466726_347789 Ga0466726_347789_74575_75285 236
131 3300042648 Ga0466709_314545 Ga0466709_314545_8057_8767 236
132 3300042593 Ga0466691_188565 Ga0466691_188565_5060_5773 237
133 3300042616 Ga0466715_029927 Ga0466715_029927_4003_4716 237
134 3300042618 Ga0466723_028077 Ga0466723_028077_4011_4724 237
135 3300042618 Ga0466723_297854 Ga0466723_297854_742_1455 237
136 3300042648 Ga0466709_371632 Ga0466709_371632_871_1584 237
137 3300042652 Ga0466708_010657 Ga0466708_010657_27198_27911 237
138 3300042620 Ga0466728_060223 Ga0466728_060223_2087_2803 238
139 3300042618 Ga0466723_217730 Ga0466723_217730_4039_4758 239
140 3300042620 Ga0466728_262266 Ga0466728_262266_4230_4961 243
141 3300042612 Ga0466705_191288 Ga0466705_191288_374_1108 244
142 3300042615 Ga0466711_366197 Ga0466711_366197_4000_4734 244
143 3300042636 Ga0466703_222314 Ga0466703_222314_8966_9700 244
144 3300042643 Ga0466704_614948 Ga0466704_614948_413_1147 244
145 3300012858 Ga0160457_1021603 Ga0160457_10216032 257
146 3300012845 Ga0160460_100002 Ga0160460_100002545 259
147 3300042599 Ga0466706_174997 Ga0466706_174997_4803_5624 262

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13507 GATase_5 CobB/CobQ-like glutamine amidotransferase domain 36 244 0.89
PF01965 DJ-1_PfpI DJ-1/PfpI family 67 135 0.88
PF07685 GATase_3 CobB/CobQ-like glutamine amidotransferase domain 59 128 0.83

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF07685 GO:0003824 catalytic activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.