Protein Family IF05644
Metagenome
Isolate
147
Members
88
Samples
114
Scaffolds
227.73
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_174997|Ga0466706_174997_4803_5624
- Length
- 262 aa
- Sequence
- VLFYFHQRLFHFNEIKECFKISYFCNLKNNKISMKFGVVIFPGSNCDHDMIYLLETLLGQQVVQLWHKDTDLQNCDMVVLPGGFSYGDYLRSGAIARLSPIMASVIDFAQRGGYVLGVCNGFQILCESHLLSGALLANNNQKFVCKNQYLTPQTNNTIFTKDAVVGKPLNIPIAHGEGRFFADAATIKHLNDKDLVLFRYCNEYGDITEEANPNGSIENIAGITNESRNVFGMMPHPERCGDSELSNTDGLVLFNSILKNIR
Sample Types
Isolate
22.4%
Metagenome
77.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
19.8%
Unclassified
16.3%
Kalotermitidae
16.3%
Apidae
11.6%
Armadillidiidae
8.1%
Drosophilidae
3.5%
Elmidae
3.5%
Passalidae
3.5%
Formicidae
3.5%
Culicidae
3.5%
Termopsidae
3.5%
Rhinotermitidae
1.2%
Nephropidae
1.2%
Hodotermitidae
1.2%
Nymphalidae
1.2%
Ixodidae
1.2%
Daphniidae
1.2%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 2 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 3 | 2820422691 | Unclassified Firmicutes Lab288P3bin58 | Isolate | Unclassified |
| 4 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 5 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 6 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 15 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 16 | 2627854132 | Campylobacter peloridis LMG 23910 | Isolate | Unclassified |
| 17 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 23 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 32 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 33 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 34 | 2599185121 | Rickettsiales bacterium Ac37b | Isolate | Ixodidae |
| 35 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 36 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 37 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 38 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 39 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 43 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 44 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 45 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 46 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 47 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 48 | 2870004507 | Campylobacter coli 14983A | Isolate | Unclassified |
| 49 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 50 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 51 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 52 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 55 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 56 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 57 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 58 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 59 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 60 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 61 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 62 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 63 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 64 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 65 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 66 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 67 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 68 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 69 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 70 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 71 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 72 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 73 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 74 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 75 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 76 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 77 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 78 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 79 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 80 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 81 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 82 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 83 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 84 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 85 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 86 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 87 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 88 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10262536 | 3300009784 | Bacteria | 1822 |
| 2 | Ga0123356_10031511 | 3300010049 | Bacteria | 4961 |
| 3 | Ga0123356_10196983 | 3300010049 | Bacteria | 2051 |
| 4 | Ga0466735_000465 | 3300042624 | Bacteria | 1196 |
| 5 | Ga0466703_222314 | 3300042636 | Bacteria | 15216 |
| 6 | Ga0160433_100005 | 3300012846 | Bacteria | 450229 |
| 7 | Ga0466691_134522 | 3300042593 | Bacteria | 1432 |
| 8 | Ga0466711_301869 | 3300042615 | Bacteria | 6206 |
| 9 | Ga0466723_071051 | 3300042618 | Bacteria | 19074 |
| 10 | Ga0466723_217730 | 3300042618 | Bacteria | 27182 |
| 11 | Ga0466728_105347 | 3300042620 | Bacteria | 39540 |
| 12 | Ga0466697_126185 | 3300042611 | Bacteria | 21012 |
| 13 | Ga0103267_1000020 | 3300007190 | Bacteria | 55669 |
| 14 | Ga0105524_106426 | 3300007733 | Bacteria | 2885 |
| 15 | Ga0123353_10020550 | 3300010167 | Bacteria | 9870 |
| 16 | Ga0466735_025506 | 3300042624 | Bacteria | 53656 |
| 17 | Ga0466735_188476 | 3300042624 | Bacteria | 1217 |
| 18 | Ga0466703_226469 | 3300042636 | Bacteria | 2317 |
| 19 | Ga0466704_614948 | 3300042643 | Bacteria | 1972 |
| 20 | Ga0160445_116342 | 3300012847 | Unclassified | 1019 |
| 21 | Ga0160443_100042 | 3300012848 | Bacteria | 306108 |
| 22 | Ga0160448_120157 | 3300012854 | Bacteria | 1095 |
| 23 | Ga0466690_304622 | 3300042590 | Bacteria | 2324 |
| 24 | Ga0466711_347073 | 3300042615 | Bacteria | 35232 |
| 25 | Ga0466723_039304 | 3300042618 | Bacteria | 36419 |
| 26 | Ga0466705_026037 | 3300042612 | Bacteria | 6908 |
| 27 | Ga0466705_314581 | 3300042612 | Bacteria | 23813 |
| 28 | 2227080785 | 2225789004 | Bacteria | 144818 |
| 29 | IMNBGM34_c001239 | 3300000036 | Bacteria | 4698 |
| 30 | JGI24695J34938_10011739 | 3300002450 | Unclassified | 4700 |
| 31 | JGI24702J35022_10003396 | 3300002462 | Bacteria | 9605 |
| 32 | Ga0123355_10032679 | 3300009826 | Bacteria | 8446 |
| 33 | Ga0123355_10880007 | 3300009826 | Bacteria | 978 |
| 34 | Ga0466706_195930 | 3300042599 | Bacteria | 86451 |
| 35 | Ga0466707_084781 | 3300042601 | Bacteria | 3090 |
| 36 | Ga0466713_008847 | 3300042602 | Bacteria | 37006 |
| 37 | Ga0466716_308099 | 3300042605 | Bacteria | 1992 |
| 38 | Ga0466704_322863 | 3300042643 | Bacteria | 1617 |
| 39 | Ga0466709_314545 | 3300042648 | Bacteria | 211401 |
| 40 | Ga0160469_102290 | 3300012824 | Bacteria | 3719 |
| 41 | Ga0160467_106095 | 3300012829 | Bacteria | 1428 |
| 42 | Ga0160436_1000001 | 3300012861 | Bacteria | 774985 |
| 43 | Ga0466690_081545 | 3300042590 | Bacteria | 5439 |
| 44 | Ga0466696_100327 | 3300042596 | Bacteria | 29738 |
| 45 | Ga0466715_181995 | 3300042616 | Bacteria | 4926 |
| 46 | Ga0466723_104511 | 3300042618 | Bacteria | 2099 |
| 47 | Ga0466723_279912 | 3300042618 | Bacteria | 33283 |
| 48 | Ga0466728_262266 | 3300042620 | Bacteria | 8432 |
| 49 | 2227571567 | 2225789004 | Bacteria | 2608 |
| 50 | Ga0072941_1216076 | 3300005201 | Bacteria | 2009 |
| 51 | Ga0123357_10114309 | 3300009784 | Bacteria | 3427 |
| 52 | Ga0466706_174997 | 3300042599 | Bacteria | 89065 |
| 53 | Ga0466719_205092 | 3300042606 | Bacteria | 1087 |
| 54 | Ga0466708_187729 | 3300042652 | Bacteria | 24305 |
| 55 | Ga0160456_100026 | 3300012820 | Bacteria | 249592 |
| 56 | Ga0160457_1001176 | 3300012858 | Bacteria | 7972 |
| 57 | Ga0466657_164306 | 3300042582 | Bacteria | 73166 |
| 58 | Ga0466696_017168 | 3300042596 | Bacteria | 5133 |
| 59 | Ga0466711_366197 | 3300042615 | Bacteria | 6867 |
| 60 | Ga0466723_313236 | 3300042618 | Bacteria | 4478 |
| 61 | Ga0466705_191288 | 3300042612 | Bacteria | 1358 |
| 62 | Ga0123355_10057375 | 3300009826 | Bacteria | 6301 |
| 63 | Ga0466709_371632 | 3300042648 | Bacteria | 1788 |
| 64 | Ga0466708_010657 | 3300042652 | Bacteria | 29621 |
| 65 | Ga0466708_278416 | 3300042652 | Bacteria | 17679 |
| 66 | Ga0160469_103142 | 3300012824 | Bacteria | 2467 |
| 67 | Ga0466693_031747 | 3300042592 | Bacteria | 1108 |
| 68 | Ga0466693_178382 | 3300042592 | Bacteria | 1862 |
| 69 | Ga0466693_358200 | 3300042592 | Unclassified | 2398 |
| 70 | Ga0466696_423255 | 3300042596 | Bacteria | 15260 |
| 71 | Ga0466712_091685 | 3300042614 | Bacteria | 2120 |
| 72 | Ga0466715_207784 | 3300042616 | Bacteria | 15692 |
| 73 | Ga0466723_005697 | 3300042618 | Bacteria | 4602 |
| 74 | Ga0466723_297854 | 3300042618 | Bacteria | 1965 |
| 75 | IMNBL1DRAFT_c0038469 | 3300000062 | Bacteria | 1644 |
| 76 | JGI24695J34938_10093355 | 3300002450 | Unclassified | 1233 |
| 77 | Ga0123355_10612411 | 3300009826 | Bacteria | 1287 |
| 78 | Ga0466702_063709 | 3300042635 | Bacteria | 1247 |
| 79 | Ga0466727_033939 | 3300042655 | Bacteria | 23538 |
| 80 | Ga0466691_032531 | 3300042593 | Bacteria | 7101 |
| 81 | Ga0466696_148382 | 3300042596 | Bacteria | 8478 |
| 82 | Ga0466726_393916 | 3300042619 | Bacteria | 1714 |
| 83 | Ga0466726_416303 | 3300042619 | Bacteria | 3126 |
| 84 | Ga0466729_164200 | 3300042621 | Bacteria | 4097 |
| 85 | Ga0466697_204917 | 3300042611 | Bacteria | 1152 |
| 86 | JGI24696J40584_12953946 | 3300002834 | Bacteria | 2559 |
| 87 | Ga0074278_115057 | 3300005721 | Bacteria | 33992 |
| 88 | Ga0103267_1000422 | 3300007190 | Bacteria | 13589 |
| 89 | Ga0103268_1000172 | 3300007192 | Bacteria | 21394 |
| 90 | Ga0123353_10545223 | 3300010167 | Bacteria | 1675 |
| 91 | Ga0466701_020243 | 3300042598 | Bacteria | 48765 |
| 92 | Ga0466713_050689 | 3300042602 | Bacteria | 16429 |
| 93 | Ga0160460_100002 | 3300012845 | Bacteria | 833437 |
| 94 | Ga0466693_129195 | 3300042592 | Bacteria | 1567 |
| 95 | Ga0466691_030891 | 3300042593 | Bacteria | 7201 |
| 96 | Ga0466691_066163 | 3300042593 | Bacteria | 3699 |
| 97 | Ga0466691_188565 | 3300042593 | Bacteria | 8128 |
| 98 | Ga0466715_029927 | 3300042616 | Bacteria | 12382 |
| 99 | Ga0466718_069090 | 3300042617 | Bacteria | 24251 |
| 100 | Ga0466726_347789 | 3300042619 | Bacteria | 126502 |
| 101 | Ga0466726_425336 | 3300042619 | Bacteria | 28796 |
| 102 | Ga0466728_060223 | 3300042620 | Bacteria | 8693 |
| 103 | JGI24695J34938_10000897 | 3300002450 | Bacteria | 27505 |
| 104 | Ga0123357_10286567 | 3300009784 | Bacteria | 1690 |
| 105 | Ga0123356_10514042 | 3300010049 | Bacteria | 1355 |
| 106 | Ga0466706_185400 | 3300042599 | Bacteria | 21442 |
| 107 | Ga0466734_002275 | 3300042623 | Bacteria | 1001 |
| 108 | Ga0466704_300405 | 3300042643 | Bacteria | 21701 |
| 109 | Ga0466708_378237 | 3300042652 | Bacteria | 28650 |
| 110 | Ga0160457_1021603 | 3300012858 | Bacteria | 900 |
| 111 | Ga0466691_004347 | 3300042593 | Bacteria | 2398 |
| 112 | Ga0466699_041148 | 3300042597 | Bacteria | 1753 |
| 113 | Ga0466711_138699 | 3300042615 | Bacteria | 27213 |
| 114 | Ga0466723_028077 | 3300042618 | Bacteria | 9409 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300009784 | Ga0123357_10262536 | Ga0123357_102625362 | 207 |
| 2 | 3300009826 | Ga0123355_10032679 | Ga0123355_100326799 | 209 |
| 3 | 3300012824 | Ga0160469_103142 | Ga0160469_1031422 | 210 |
| 4 | 3300012858 | Ga0160457_1001176 | Ga0160457_10011768 | 210 |
| 5 | 3300042590 | Ga0466690_081545 | Ga0466690_081545_3733_4371 | 212 |
| 6 | 3300042643 | Ga0466704_300405 | Ga0466704_300405_6225_6863 | 212 |
| 7 | iso_pr_bacteria | 2767802234 | 2769328793 | 212 |
| 8 | 3300042593 | Ga0466691_004347 | Ga0466691_004347_1290_1931 | 213 |
| 9 | 3300042596 | Ga0466696_148382 | Ga0466696_148382_1809_2450 | 213 |
| 10 | 3300042596 | Ga0466696_423255 | Ga0466696_423255_2295_2936 | 213 |
| 11 | 3300042611 | Ga0466697_126185 | Ga0466697_126185_721_1362 | 213 |
| 12 | 3300042612 | Ga0466705_026037 | Ga0466705_026037_827_1468 | 213 |
| 13 | 3300042615 | Ga0466711_347073 | Ga0466711_347073_5286_5927 | 213 |
| 14 | 3300042618 | Ga0466723_279912 | Ga0466723_279912_26969_27610 | 213 |
| 15 | iso_pr_bacteria | 2870004507 | 2870005935 | 214 |
| 16 | 3300005201 | Ga0072941_1216076 | Ga0072941_12160762 | 215 |
| 17 | 3300042599 | Ga0466706_195930 | Ga0466706_195930_3575_4222 | 215 |
| 18 | 3300042611 | Ga0466697_204917 | Ga0466697_204917_119_817 | 215 |
| 19 | iso_pr_bacteria | 2627854132 | 2630357904 | 215 |
| 20 | 3300042592 | Ga0466693_129195 | Ga0466693_129195_241_903 | 220 |
| 21 | iso_pr_bacteria | 2864866972 | 2864869298 | 220 |
| 22 | iso_pr_bacteria | 2864934081 | 2864935898 | 220 |
| 23 | iso_pr_bacteria | 2864951976 | 2864953879 | 220 |
| 24 | 3300009826 | Ga0123355_10057375 | Ga0123355_100573755 | 221 |
| 25 | 3300012820 | Ga0160456_100026 | Ga0160456_10002634 | 221 |
| 26 | 3300012824 | Ga0160469_102290 | Ga0160469_1022902 | 221 |
| 27 | 3300012846 | Ga0160433_100005 | Ga0160433_100005398 | 221 |
| 28 | 3300012847 | Ga0160445_116342 | Ga0160445_1163422 | 221 |
| 29 | 3300012854 | Ga0160448_120157 | Ga0160448_1201571 | 221 |
| 30 | 3300012861 | Ga0160436_1000001 | Ga0160436_1000001630 | 221 |
| 31 | 3300042619 | Ga0466726_425336 | Ga0466726_425336_5372_6037 | 221 |
| 32 | iso_pr_bacteria | 2619619079 | 2620605518 | 221 |
| 33 | iso_pr_bacteria | 2820673891 | 2820675614 | 221 |
| 34 | iso_pr_bacteria | 2820685979 | 2820688046 | 221 |
| 35 | 3300002450 | JGI24695J34938_10000897 | JGI24695J34938_1000089716 | 222 |
| 36 | 3300042602 | Ga0466713_050689 | Ga0466713_050689_11586_12254 | 222 |
| 37 | iso_pr_bacteria | 2820398208 | 2820399239 | 222 |
| 38 | iso_pr_bacteria | 2835143510 | 2835144592 | 222 |
| 39 | 3300009826 | Ga0123355_10880007 | Ga0123355_108800071 | 223 |
| 40 | 3300042592 | Ga0466693_178382 | Ga0466693_178382_693_1364 | 223 |
| 41 | 3300007733 | Ga0105524_106426 | Ga0105524_1064262 | 224 |
| 42 | 3300009826 | Ga0123355_10612411 | Ga0123355_106124112 | 224 |
| 43 | 3300010167 | Ga0123353_10545223 | Ga0123353_105452233 | 224 |
| 44 | 3300042592 | Ga0466693_031747 | Ga0466693_031747_195_869 | 224 |
| 45 | 3300042592 | Ga0466693_358200 | Ga0466693_358200_916_1590 | 224 |
| 46 | iso_pr_bacteria | 2820607737 | 2820609724 | 224 |
| 47 | 3300002450 | JGI24695J34938_10011739 | JGI24695J34938_100117394 | 225 |
| 48 | 3300002450 | JGI24695J34938_10093355 | JGI24695J34938_100933552 | 225 |
| 49 | 3300002834 | JGI24696J40584_12953946 | JGI24696J40584_129539462 | 225 |
| 50 | 3300042618 | Ga0466723_104511 | Ga0466723_104511_30_707 | 225 |
| 51 | 3300042636 | Ga0466703_226469 | Ga0466703_226469_206_904 | 226 |
| 52 | 3300009784 | Ga0123357_10114309 | Ga0123357_101143091 | 227 |
| 53 | 3300042605 | Ga0466716_308099 | Ga0466716_308099_953_1672 | 227 |
| 54 | 3300042618 | Ga0466723_005697 | Ga0466723_005697_3255_3938 | 227 |
| 55 | 3300042623 | Ga0466734_002275 | Ga0466734_002275_76_759 | 227 |
| 56 | iso_pr_bacteria | 2916858470 | 2916859833 | 227 |
| 57 | iso_pr_bacteria | 8064008355 | 8064013452 | 227 |
| 58 | 3300042582 | Ga0466657_164306 | Ga0466657_164306_3923_4609 | 228 |
| 59 | 3300042590 | Ga0466690_304622 | Ga0466690_304622_1267_1953 | 228 |
| 60 | 3300042618 | Ga0466723_071051 | Ga0466723_071051_508_1194 | 228 |
| 61 | 3300042618 | Ga0466723_313236 | Ga0466723_313236_952_1671 | 228 |
| 62 | 3300042620 | Ga0466728_105347 | Ga0466728_105347_36015_36701 | 228 |
| 63 | 3300042624 | Ga0466735_000465 | Ga0466735_000465_124_810 | 228 |
| 64 | 3300042624 | Ga0466735_188476 | Ga0466735_188476_12_698 | 228 |
| 65 | 3300042652 | Ga0466708_187729 | Ga0466708_187729_14594_15280 | 228 |
| 66 | iso_pr_bacteria | 2595698190 | 2596206254 | 228 |
| 67 | iso_pr_bacteria | 2595698193 | 2596211665 | 228 |
| 68 | iso_pr_bacteria | 2595698194 | 2596213387 | 228 |
| 69 | iso_pr_bacteria | 2595698195 | 2596215426 | 228 |
| 70 | iso_pr_bacteria | 2595698196 | 2596217167 | 228 |
| 71 | iso_pr_bacteria | 2595698197 | 2596219004 | 228 |
| 72 | iso_pr_bacteria | 2595698198 | 2596220836 | 228 |
| 73 | iso_pr_bacteria | 2595698199 | 2596222640 | 228 |
| 74 | iso_pr_bacteria | 2627853628 | 2628280967 | 228 |
| 75 | iso_pr_bacteria | 2890957088 | 2890959491 | 228 |
| 76 | iso_pr_bacteria | 650716050 | 650845571 | 228 |
| 77 | 3300007190 | Ga0103267_1000020 | Ga0103267_10000204 | 229 |
| 78 | 3300042593 | Ga0466691_134522 | Ga0466691_134522_106_795 | 229 |
| 79 | 3300042597 | Ga0466699_041148 | Ga0466699_041148_42_731 | 229 |
| 80 | 3300042598 | Ga0466701_020243 | Ga0466701_020243_29635_30324 | 229 |
| 81 | 3300042599 | Ga0466706_185400 | Ga0466706_185400_3967_4656 | 229 |
| 82 | 3300042601 | Ga0466707_084781 | Ga0466707_084781_1920_2609 | 229 |
| 83 | 3300042602 | Ga0466713_008847 | Ga0466713_008847_15732_16421 | 229 |
| 84 | 3300042606 | Ga0466719_205092 | Ga0466719_205092_277_966 | 229 |
| 85 | 3300042615 | Ga0466711_301869 | Ga0466711_301869_3425_4114 | 229 |
| 86 | 3300042618 | Ga0466723_039304 | Ga0466723_039304_15562_16251 | 229 |
| 87 | 3300042619 | Ga0466726_416303 | Ga0466726_416303_1098_1787 | 229 |
| 88 | 3300042621 | Ga0466729_164200 | Ga0466729_164200_2999_3688 | 229 |
| 89 | 3300042655 | Ga0466727_033939 | Ga0466727_033939_18218_18907 | 229 |
| 90 | iso_pr_bacteria | 2983866074 | 2983867537 | 229 |
| 91 | 3300002462 | JGI24702J35022_10003396 | JGI24702J35022_1000339610 | 230 |
| 92 | 3300007190 | Ga0103267_1000422 | Ga0103267_100042210 | 230 |
| 93 | 3300010049 | Ga0123356_10031511 | Ga0123356_100315113 | 230 |
| 94 | 3300010049 | Ga0123356_10514042 | Ga0123356_105140422 | 230 |
| 95 | 3300042614 | Ga0466712_091685 | Ga0466712_091685_1138_1830 | 230 |
| 96 | 3300042616 | Ga0466715_207784 | Ga0466715_207784_8973_9665 | 230 |
| 97 | 3300042624 | Ga0466735_025506 | Ga0466735_025506_1095_1787 | 230 |
| 98 | 3300042652 | Ga0466708_278416 | Ga0466708_278416_1738_2430 | 230 |
| 99 | iso_pr_bacteria | 2590828803 | 2592927051 | 230 |
| 100 | iso_pr_bacteria | 2599185121 | 2599225102 | 230 |
| 101 | 2225789004 | 2227080785 | 2227453473 | 231 |
| 102 | 3300000036 | IMNBGM34_c001239 | IMNBGM34_0012392 | 231 |
| 103 | 3300009784 | Ga0123357_10286567 | Ga0123357_102865673 | 231 |
| 104 | 3300010049 | Ga0123356_10196983 | Ga0123356_101969834 | 231 |
| 105 | 3300012848 | Ga0160443_100042 | Ga0160443_100042173 | 231 |
| 106 | 3300042617 | Ga0466718_069090 | Ga0466718_069090_8726_9421 | 231 |
| 107 | 3300042593 | Ga0466691_032531 | Ga0466691_032531_5660_6358 | 232 |
| 108 | 3300042596 | Ga0466696_017168 | Ga0466696_017168_4306_5004 | 232 |
| 109 | 3300042615 | Ga0466711_138699 | Ga0466711_138699_1688_2386 | 232 |
| 110 | 3300042652 | Ga0466708_378237 | Ga0466708_378237_9783_10481 | 232 |
| 111 | iso_pr_bacteria | 2891591111 | 2891592046 | 232 |
| 112 | 3300005721 | Ga0074278_115057 | Ga0074278_1150572 | 233 |
| 113 | 3300042593 | Ga0466691_066163 | Ga0466691_066163_1287_1988 | 233 |
| 114 | 3300042596 | Ga0466696_100327 | Ga0466696_100327_12895_13596 | 233 |
| 115 | 3300042635 | Ga0466702_063709 | Ga0466702_063709_469_1170 | 233 |
| 116 | iso_pr_bacteria | 2513237339 | 2514544588 | 233 |
| 117 | iso_pr_bacteria | 2775507278 | 2778219824 | 233 |
| 118 | iso_pr_bacteria | 2835008077 | 2835008531 | 233 |
| 119 | 3300012829 | Ga0160467_106095 | Ga0160467_1060952 | 234 |
| 120 | 3300042593 | Ga0466691_030891 | Ga0466691_030891_4004_4708 | 234 |
| 121 | 3300042612 | Ga0466705_314581 | Ga0466705_314581_7834_8538 | 234 |
| 122 | 3300042619 | Ga0466726_393916 | Ga0466726_393916_700_1404 | 234 |
| 123 | 3300042643 | Ga0466704_322863 | Ga0466704_322863_13_717 | 234 |
| 124 | iso_pr_bacteria | 2820422691 | 2820423716 | 234 |
| 125 | 2225789004 | 2227571567 | 2228116895 | 235 |
| 126 | 3300000062 | IMNBL1DRAFT_c0038469 | IMNBL1DRAFT_00384693 | 235 |
| 127 | 3300007192 | Ga0103268_1000172 | Ga0103268_100017214 | 235 |
| 128 | 3300010167 | Ga0123353_10020550 | Ga0123353_100205502 | 235 |
| 129 | 3300042616 | Ga0466715_181995 | Ga0466715_181995_1956_2666 | 236 |
| 130 | 3300042619 | Ga0466726_347789 | Ga0466726_347789_74575_75285 | 236 |
| 131 | 3300042648 | Ga0466709_314545 | Ga0466709_314545_8057_8767 | 236 |
| 132 | 3300042593 | Ga0466691_188565 | Ga0466691_188565_5060_5773 | 237 |
| 133 | 3300042616 | Ga0466715_029927 | Ga0466715_029927_4003_4716 | 237 |
| 134 | 3300042618 | Ga0466723_028077 | Ga0466723_028077_4011_4724 | 237 |
| 135 | 3300042618 | Ga0466723_297854 | Ga0466723_297854_742_1455 | 237 |
| 136 | 3300042648 | Ga0466709_371632 | Ga0466709_371632_871_1584 | 237 |
| 137 | 3300042652 | Ga0466708_010657 | Ga0466708_010657_27198_27911 | 237 |
| 138 | 3300042620 | Ga0466728_060223 | Ga0466728_060223_2087_2803 | 238 |
| 139 | 3300042618 | Ga0466723_217730 | Ga0466723_217730_4039_4758 | 239 |
| 140 | 3300042620 | Ga0466728_262266 | Ga0466728_262266_4230_4961 | 243 |
| 141 | 3300042612 | Ga0466705_191288 | Ga0466705_191288_374_1108 | 244 |
| 142 | 3300042615 | Ga0466711_366197 | Ga0466711_366197_4000_4734 | 244 |
| 143 | 3300042636 | Ga0466703_222314 | Ga0466703_222314_8966_9700 | 244 |
| 144 | 3300042643 | Ga0466704_614948 | Ga0466704_614948_413_1147 | 244 |
| 145 | 3300012858 | Ga0160457_1021603 | Ga0160457_10216032 | 257 |
| 146 | 3300012845 | Ga0160460_100002 | Ga0160460_100002545 | 259 |
| 147 | 3300042599 | Ga0466706_174997 | Ga0466706_174997_4803_5624 | 262 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07685 | GO:0003824 | catalytic activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.