Protein Family IF05628

Metagenome Isolate
159 Members
65 Samples
127 Scaffolds
344.78 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_151904|Ga0466706_151904_403_1518
Length
371 aa
Sequence
MHKTGTFFKGFNKMLETSSFEFDADISAERLVSPRETEIDSTDDIDLTLRPKTLSEYIGQDKVKENMAVFIEAARKRAEPLDHVLLYGPPGLGKTTLSCIIAHEMGVNIRITSGPAIEKAGDLAAILTNLSPNDVLFIDEIHRLNRQVEEIMYPALEDYALDIIVGKGPSARSIRIDLPKFTLIGATTRAGQLSAPLRDRFGVVMRLELYNFEQLTDIVLRSSVILGIPCDKAGALEIAKRSRGTPRIANRLLKRVRDFAEVLGTGKVTEEIAKIALDRLEIDSXGLDSMDKRFLEMIIKGYSGGPVGLETLAAAIGEEAVTLEDVCEPYLMQLGFLSRTPRGRCATAIAYNHMGYQAPAVIQTPQISLLD

📊 Sample Types

Isolate 20.1%
Metagenome 79.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 40.0%
Termitidae 27.7%
Kalotermitidae 13.8%
Blattidae 4.6%
Termopsidae 3.1%
Passalidae 3.1%
Stratiomyidae 3.1%
Hodotermitidae 1.5%
Scarabaeidae 1.5%
Apidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 142
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820646798 Unclassified Firmicutes Cu122P5bin36 Isolate Unclassified
2 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
3 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
4 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
5 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
6 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
7 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
8 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
9 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
10 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
11 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
12 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
15 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
16 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
17 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
18 2820510699 Unclassified Firmicutes Lab288P1bin40 Isolate Unclassified
19 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
25 2590828839 Clostridium sp. 1 Isolate Termitidae
26 2820651690 Unclassified Firmicutes Cu122P3bin6 Isolate Unclassified
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
33 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
34 2820348946 Unclassified Firmicutes Nt197P3bin47 Isolate Unclassified
35 2820467504 Unclassified Firmicutes Lab288P3bin1 Isolate Unclassified
36 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
37 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
38 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
39 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
40 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
41 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
42 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
43 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
45 2820893114 Unclassified Actinobacteria Lab288P1bin125 Isolate Unclassified
46 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
47 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
48 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
49 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
50 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
51 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
54 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
55 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
56 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
57 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
58 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
59 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
60 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
61 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
62 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
63 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
64 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
65 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_173350 3300042615 Bacteria 4089
2 Ga0466728_414994 3300042620 Bacteria 45354
3 Ga0123357_10080426 3300009784 Bacteria 4286
4 Ga0123355_10225800 3300009826 Bacteria 2684
5 Ga0123356_10032501 3300010049 Bacteria 4880
6 Ga0123356_10125962 3300010049 Bacteria 2500
7 Ga0123353_10217445 3300010167 Bacteria 2992
8 Ga0123353_10222094 3300010167 Bacteria 2953
9 Ga0123353_10387812 3300010167 Bacteria 2086
10 Ga0466706_045867 3300042599 Unclassified 46170
11 Ga0466706_174323 3300042599 Unclassified 1719
12 Ga0466706_206119 3300042599 Unclassified 3252
13 Ga0466706_236537 3300042599 Bacteria 33431
14 Ga0466707_410083 3300042601 Bacteria 48627
15 IMNBL1DRAFT_c0025788 3300000062 Bacteria 2248
16 Ga0415639_206963 3300038395 Bacteria 2448
17 Ga0466693_013649 3300042592 Bacteria 10103
18 Ga0123356_10032358 3300010049 Bacteria 4893
19 Ga0123353_10033146 3300010167 Bacteria 8036
20 Ga0466702_455829 3300042635 Bacteria 56693
21 Ga0466703_083574 3300042636 Bacteria 2666
22 Ga0466724_01455 3300042649 Bacteria 1081
23 Ga0466706_021154 3300042599 Bacteria 130141
24 Ga0466706_123002 3300042599 Bacteria 8824
25 Ga0466706_159735 3300042599 Unclassified 17015
26 Ga0466706_210189 3300042599 Bacteria 1388
27 Ga0466706_272557 3300042599 Unclassified 2062
28 Ga0466733_135572 3300042659 Bacteria 3568
29 Ga0415639_015433 3300038395 Bacteria 26756
30 Ga0466695_189537 3300042595 Bacteria 2725
31 Ga0123355_10012522 3300009826 Bacteria 13142
32 Ga0123355_10296264 3300009826 Bacteria 2212
33 Ga0466703_139813 3300042636 Bacteria 21578
34 Ga0466706_093098 3300042599 Bacteria 10369
35 Ga0466706_137149 3300042599 Bacteria 27048
36 2227644055 2225789004 Bacteria 10970
37 Ga0466733_132231 3300042659 Bacteria 1680
38 Ga0466711_031756 3300042615 Bacteria 5123
39 Ga0466726_031487 3300042619 Bacteria 6338
40 Ga0123357_10035958 3300009784 Bacteria 6737
41 Ga0123355_10005830 3300009826 Bacteria 18118
42 Ga0123355_10020298 3300009826 Unclassified 10606
43 Ga0123355_10052497 3300009826 Bacteria 6613
44 Ga0123353_10057610 3300010167 Bacteria 6224
45 Ga0466735_003456 3300042624 Bacteria 38500
46 Ga0466702_145428 3300042635 Bacteria 52890
47 Ga0466702_377813 3300042635 Bacteria 3157
48 Ga0466708_052469 3300042652 Bacteria 21078
49 Ga0466706_096421 3300042599 Bacteria 77752
50 Ga0466706_107205 3300042599 Bacteria 176653
51 Ga0072940_1006101 3300005200 Bacteria 21732
52 Ga0466715_255950 3300042616 Bacteria 9027
53 Ga0466715_449604 3300042616 Bacteria 3964
54 Ga0415639_023872 3300038395 Bacteria 23257
55 Ga0123353_10110673 3300010167 Bacteria 4425
56 Ga0123353_10251602 3300010167 Bacteria 2736
57 Ga0466704_295438 3300042643 Bacteria 4615
58 Ga0466706_007585 3300042599 Unclassified 14065
59 Ga0466706_054284 3300042599 Bacteria 5989
60 Ga0466706_065936 3300042599 Bacteria 9827
61 Ga0466706_145847 3300042599 Bacteria 2378
62 Ga0466706_150379 3300042599 Unclassified 23702
63 Ga0466706_151904 3300042599 Bacteria 2485
64 Ga0466706_205990 3300042599 Unclassified 63346
65 Ga0466706_217022 3300042599 Unclassified 2028
66 Ga0466706_285786 3300042599 Unclassified 1771
67 Ga0466700_379778 3300042600 Bacteria 1014
68 Ga0466713_130289 3300042602 Bacteria 9656
69 2227469065 2225789004 Bacteria 24255
70 IMNBL1DRAFT_c0036199 3300000062 Bacteria 1727
71 AustNasuHG_c1000068 3300000089 Bacteria 28518
72 Ga0466733_144688 3300042659 Bacteria 13024
73 Ga0466696_293318 3300042596 Bacteria 15923
74 Ga0123355_10000014 3300009826 Bacteria 174606
75 Ga0123355_10503781 3300009826 Bacteria 1492
76 Ga0123356_10150465 3300010049 Unclassified 2310
77 Ga0123353_10278036 3300010167 Bacteria 2574
78 Ga0466706_048704 3300042599 Unclassified 4460
79 Ga0466706_055246 3300042599 Bacteria 3415
80 Ga0466706_155338 3300042599 Bacteria 8003
81 Ga0466706_174660 3300042599 Bacteria 4083
82 Ga0466698_418298 3300042610 Bacteria 6308
83 JGI24705J35276_12238286 3300002504 Bacteria 18525
84 Ga0466705_347109 3300042612 Bacteria 3969
85 Ga0466711_507820 3300042615 Bacteria 7124
86 Ga0123355_10000837 3300009826 Bacteria 42313
87 Ga0123355_10026558 3300009826 Bacteria 9342
88 Ga0123355_10155280 3300009826 Bacteria 3464
89 Ga0123353_10000357 3300010167 Bacteria 55827
90 Ga0123353_10001944 3300010167 Bacteria 25461
91 Ga0123353_10143217 3300010167 Bacteria 3826
92 Ga0466704_076757 3300042643 Bacteria 271570
93 Ga0466704_209233 3300042643 Bacteria 84587
94 Ga0466704_221920 3300042643 Bacteria 2202
95 Ga0466706_013141 3300042599 Bacteria 2961
96 Ga0466706_018824 3300042599 Bacteria 21960
97 Ga0466706_024018 3300042599 Bacteria 9586
98 Ga0466706_034637 3300042599 Unclassified 29373
99 Ga0466706_079931 3300042599 Bacteria 110819
100 Ga0466706_100866 3300042599 Bacteria 3097
101 Ga0466706_101814 3300042599 Bacteria 31962
102 Ga0466706_112167 3300042599 Bacteria 25695
103 Ga0466706_194221 3300042599 Unclassified 7177
104 Ga0466706_211029 3300042599 Bacteria 1350
105 Ga0466706_224804 3300042599 Bacteria 61366
106 Ga0466716_183734 3300042605 Bacteria 316127
107 Ga0466733_019351 3300042659 Bacteria 7450
108 Ga0466715_535374 3300042616 Bacteria 53013
109 Ga0415639_182851 3300038395 Bacteria 3309
110 Ga0466696_085965 3300042596 Bacteria 5863
111 Ga0123355_10009341 3300009826 Bacteria 14895
112 Ga0123355_10030997 3300009826 Bacteria 8673
113 Ga0123355_10113049 3300009826 Unclassified 4236
114 Ga0123356_10000006 3300010049 Bacteria 247371
115 Ga0123356_10061704 3300010049 Bacteria 3501
116 Ga0123353_10002516 3300010167 Bacteria 22784
117 Ga0123353_10006345 3300010167 Bacteria 15730
118 Ga0466704_330894 3300042643 Bacteria 161855
119 Ga0466706_036800 3300042599 Unclassified 31228
120 Ga0466706_046212 3300042599 Bacteria 4335
121 Ga0466706_189447 3300042599 Bacteria 7335
122 Ga0466713_136032 3300042602 Bacteria 7347
123 Ga0466714_024749 3300042603 Bacteria 9532
124 IMNBL1DRAFT_c0005266 3300000062 Bacteria 7456
125 JGI24702J35022_10029380 3300002462 Bacteria 2950
126 JGI24705J35276_12238177 3300002504 Bacteria 16905
127 JGI24705J35276_12238248 3300002504 Bacteria 17831

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10035958 Ga0123357_100359583 302
2 3300000062 IMNBL1DRAFT_c0036199 IMNBL1DRAFT_00361992 309
3 3300042600 Ga0466700_379778 Ga0466700_379778_55_987 310
4 3300038395 Ga0415639_206963 Ga0415639_206963_956_1891 311
5 iso_pr_bacteria 2820893114 2820894070 312
6 3300009826 Ga0123355_10503781 Ga0123355_105037811 319
7 3300009826 Ga0123355_10000837 Ga0123355_100008379 323
8 3300010049 Ga0123356_10150465 Ga0123356_101504653 326
9 3300042615 Ga0466711_507820 Ga0466711_507820_3360_4409 327
10 3300042635 Ga0466702_145428 Ga0466702_145428_10259_11332 327
11 3300042615 Ga0466711_031756 Ga0466711_031756_2735_3724 329
12 3300000062 IMNBL1DRAFT_c0005266 IMNBL1DRAFT_00052664 331
13 3300010167 Ga0123353_10222094 Ga0123353_102220943 331
14 3300042599 Ga0466706_024018 Ga0466706_024018_2187_3182 331
15 3300042599 Ga0466706_055246 Ga0466706_055246_2370_3365 331
16 3300042599 Ga0466706_155338 Ga0466706_155338_1187_2182 331
17 iso_pr_bacteria 2963634138 2963635476 331
18 iso_pr_bacteria 2963635624 2963635852 331
19 3300009784 Ga0123357_10080426 Ga0123357_100804262 332
20 3300042620 Ga0466728_414994 Ga0466728_414994_37034_38032 332
21 iso_pr_bacteria 2820646798 2820647268 332
22 3300042592 Ga0466693_013649 Ga0466693_013649_5699_6703 334
23 3300042595 Ga0466695_189537 Ga0466695_189537_1125_2129 334
24 3300042649 Ga0466724_01455 Ga0466724_01455_21_1025 334
25 iso_pr_bacteria 2820467504 2820468280 334
26 iso_pr_bacteria 2971438493 2971439428 334
27 3300010167 Ga0123353_10143217 Ga0123353_101432173 335
28 3300042599 Ga0466706_107205 Ga0466706_107205_45085_46092 335
29 3300042616 Ga0466715_449604 Ga0466715_449604_2383_3390 335
30 iso_pr_bacteria 2820477775 2820478419 335
31 3300010049 Ga0123356_10032358 Ga0123356_100323584 336
32 iso_pr_bacteria 8030337018 8030337980 336
33 iso_pr_bacteria 8030343600 8030345968 336
34 3300042610 Ga0466698_418298 Ga0466698_418298_3961_4977 338
35 3300042596 Ga0466696_293318 Ga0466696_293318_2465_3484 339
36 3300042624 Ga0466735_003456 Ga0466735_003456_32586_33605 339
37 3300000062 IMNBL1DRAFT_c0025788 IMNBL1DRAFT_00257881 340
38 3300009826 Ga0123355_10296264 Ga0123355_102962642 340
39 3300042599 Ga0466706_093098 Ga0466706_093098_4495_5565 340
40 3300042599 Ga0466706_217022 Ga0466706_217022_398_1468 340
41 3300042643 Ga0466704_330894 Ga0466704_330894_63660_64682 340
42 3300042652 Ga0466708_052469 Ga0466708_052469_3359_4381 340
43 iso_pr_bacteria 2820314258 2820316461 340
44 iso_pr_bacteria 2820324456 2820325909 340
45 iso_pr_bacteria 2820613375 2820613552 340
46 3300002504 JGI24705J35276_12238177 JGI24705J35276_1223817711 341
47 3300042616 Ga0466715_535374 Ga0466715_535374_47358_48383 341
48 iso_pr_bacteria 2820420508 2820421598 341
49 iso_pr_bacteria 2820651690 2820652555 341
50 3300010167 Ga0123353_10033146 Ga0123353_100331466 342
51 3300042602 Ga0466713_130289 Ga0466713_130289_6454_7482 342
52 3300042603 Ga0466714_024749 Ga0466714_024749_5694_6722 342
53 iso_pr_bacteria 2634166424 2635617221 342
54 iso_pr_bacteria 2820525019 2820526778 342
55 3300009826 Ga0123355_10026558 Ga0123355_100265587 343
56 3300009826 Ga0123355_10113049 Ga0123355_101130492 343
57 3300010167 Ga0123353_10110673 Ga0123353_101106732 343
58 3300042643 Ga0466704_221920 Ga0466704_221920_119_1150 343
59 3300042643 Ga0466704_295438 Ga0466704_295438_413_1444 343
60 iso_pr_bacteria 2820250282 2820251556 343
61 3300009826 Ga0123355_10000014 Ga0123355_10000014167 344
62 3300042596 Ga0466696_085965 Ga0466696_085965_4711_5745 344
63 3300042615 Ga0466711_173350 Ga0466711_173350_1024_2058 344
64 3300042616 Ga0466715_255950 Ga0466715_255950_1446_2480 344
65 iso_pr_bacteria 2820488713 2820490693 344
66 3300042612 Ga0466705_347109 Ga0466705_347109_2722_3759 345
67 iso_pr_bacteria 2820570671 2820571010 345
68 3300002462 JGI24702J35022_10029380 JGI24702J35022_100293801 346
69 3300009826 Ga0123355_10020298 Ga0123355_100202987 346
70 3300009826 Ga0123355_10225800 Ga0123355_102258003 346
71 3300010049 Ga0123356_10000006 Ga0123356_1000000694 346
72 3300010167 Ga0123353_10002516 Ga0123353_1000251620 346
73 3300010167 Ga0123353_10278036 Ga0123353_102780362 346
74 3300010167 Ga0123353_10387812 Ga0123353_103878123 346
75 3300042601 Ga0466707_410083 Ga0466707_410083_36094_37134 346
76 3300042619 Ga0466726_031487 Ga0466726_031487_3145_4185 346
77 3300042635 Ga0466702_455829 Ga0466702_455829_22811_23851 346
78 iso_pr_bacteria 2820348946 2820349624 346
79 iso_pr_bacteria 2820474468 2820476090 346
80 iso_pr_bacteria 2820510699 2820512061 346
81 iso_pr_bacteria 2820584674 2820586424 346
82 3300009826 Ga0123355_10030997 Ga0123355_100309977 347
83 3300009826 Ga0123355_10052497 Ga0123355_100524972 347
84 3300010167 Ga0123353_10000357 Ga0123353_1000035749 347
85 3300010167 Ga0123353_10251602 Ga0123353_102516022 347
86 3300042605 Ga0466716_183734 Ga0466716_183734_213017_214060 347
87 3300042643 Ga0466704_209233 Ga0466704_209233_17886_18965 347
88 iso_pr_bacteria 2820353569 2820354939 347
89 iso_pr_bacteria 2820429680 2820431024 347
90 iso_pr_bacteria 2820504582 2820505454 347
91 3300005200 Ga0072940_1006101 Ga0072940_10061012 348
92 3300010167 Ga0123353_10001944 Ga0123353_100019447 348
93 3300038395 Ga0415639_015433 Ga0415639_015433_20154_21200 348
94 iso_pr_bacteria 2590828839 2593252524 348
95 3300000089 AustNasuHG_c1000068 AustNasuHG_100006810 349
96 3300002504 JGI24705J35276_12238248 JGI24705J35276_122382484 349
97 3300002504 JGI24705J35276_12238286 JGI24705J35276_122382869 349
98 3300009826 Ga0123355_10005830 Ga0123355_100058309 349
99 3300009826 Ga0123355_10009341 Ga0123355_100093418 349
100 3300010049 Ga0123356_10061704 Ga0123356_100617044 349
101 3300038395 Ga0415639_182851 Ga0415639_182851_1300_2349 349
102 3300042635 Ga0466702_377813 Ga0466702_377813_1974_3023 349
103 3300042599 Ga0466706_013141 Ga0466706_013141_1116_2168 350
104 3300042659 Ga0466733_019351 Ga0466733_019351_3787_4839 350
105 3300042599 Ga0466706_048704 Ga0466706_048704_3075_4130 351
106 3300042599 Ga0466706_206119 Ga0466706_206119_555_1610 351
107 3300042659 Ga0466733_135572 Ga0466733_135572_976_2031 351
108 iso_pr_bacteria 2820280018 2820280121 351
109 iso_pr_bacteria 2820460928 2820461313 351
110 iso_pr_bacteria 2940228231 2940228773 351
111 3300010167 Ga0123353_10057610 Ga0123353_100576104 352
112 3300038395 Ga0415639_023872 Ga0415639_023872_16248_17306 352
113 2225789004 2227644055 2228235195 353
114 3300042599 Ga0466706_018824 Ga0466706_018824_20795_21856 353
115 3300042599 Ga0466706_021154 Ga0466706_021154_100376_101437 353
116 3300042599 Ga0466706_034637 Ga0466706_034637_9246_10307 353
117 3300042599 Ga0466706_036800 Ga0466706_036800_18381_19442 353
118 3300042599 Ga0466706_065936 Ga0466706_065936_2045_3106 353
119 3300042599 Ga0466706_079931 Ga0466706_079931_95835_96896 353
120 3300042599 Ga0466706_100866 Ga0466706_100866_1732_2793 353
121 3300042599 Ga0466706_101814 Ga0466706_101814_9739_10800 353
122 3300042599 Ga0466706_123002 Ga0466706_123002_5933_6994 353
123 3300042599 Ga0466706_137149 Ga0466706_137149_10684_11745 353
124 3300042599 Ga0466706_150379 Ga0466706_150379_1165_2226 353
125 3300042599 Ga0466706_159735 Ga0466706_159735_14790_15851 353
126 3300042599 Ga0466706_174323 Ga0466706_174323_599_1660 353
127 3300042599 Ga0466706_210189 Ga0466706_210189_40_1101 353
128 3300042599 Ga0466706_211029 Ga0466706_211029_28_1089 353
129 3300042599 Ga0466706_272557 Ga0466706_272557_793_1854 353
130 3300042636 Ga0466703_139813 Ga0466703_139813_14188_15249 353
131 3300042659 Ga0466733_144688 Ga0466733_144688_3051_4112 353
132 3300010049 Ga0123356_10032501 Ga0123356_100325012 354
133 3300010167 Ga0123353_10217445 Ga0123353_102174452 354
134 3300042599 Ga0466706_045867 Ga0466706_045867_11756_12820 354
135 3300042599 Ga0466706_112167 Ga0466706_112167_6014_7078 354
136 3300042599 Ga0466706_174660 Ga0466706_174660_990_2054 354
137 3300042599 Ga0466706_189447 Ga0466706_189447_320_1384 354
138 iso_pr_bacteria 2820265624 2820266300 354
139 2225789004 2227469065 2227911988 355
140 3300042659 Ga0466733_132231 Ga0466733_132231_350_1417 355
141 3300009826 Ga0123355_10155280 Ga0123355_101552802 356
142 3300010167 Ga0123353_10006345 Ga0123353_1000634514 356
143 3300042599 Ga0466706_205990 Ga0466706_205990_48466_49536 356
144 3300042599 Ga0466706_224804 Ga0466706_224804_47165_48235 356
145 3300042599 Ga0466706_236537 Ga0466706_236537_16708_17778 356
146 3300042602 Ga0466713_136032 Ga0466713_136032_1875_2945 356
147 3300042599 Ga0466706_007585 Ga0466706_007585_1790_2863 357
148 3300042599 Ga0466706_054284 Ga0466706_054284_3664_4737 357
149 3300042599 Ga0466706_096421 Ga0466706_096421_11778_12851 357
150 iso_pr_bacteria 2820360414 2820361818 358
151 3300010049 Ga0123356_10125962 Ga0123356_101259622 359
152 3300042599 Ga0466706_194221 Ga0466706_194221_4364_5443 359
153 3300042599 Ga0466706_285786 Ga0466706_285786_88_1167 359
154 3300009826 Ga0123355_10012522 Ga0123355_100125226 360
155 3300042599 Ga0466706_046212 Ga0466706_046212_2922_4004 360
156 3300042636 Ga0466703_083574 Ga0466703_083574_1166_2398 361
157 3300042643 Ga0466704_076757 Ga0466704_076757_90404_91492 362
158 3300042599 Ga0466706_145847 Ga0466706_145847_1197_2291 364
159 3300042599 Ga0466706_151904 Ga0466706_151904_403_1518 371

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17864 AAA_lid_4 RuvB AAA lid domain 210 283 0.99
PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain 49 207 0.99
PF05491 RuvB_C RuvB C-terminal winged helix domain 285 354 0.98
PF00004 AAA ATPase family associated with various cellular activities (AAA) 84 208 0.95
PF07728 AAA_5 AAA domain (dynein-related subfamily) 83 201 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.