Protein Family IF05593
Metagenome
Isolate
159
Members
87
Samples
105
Scaffolds
263.74
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_081639|Ga0466706_081639_336_1268
- Length
- 310 aa
- Sequence
- VECVLQSVCGNFGYGGVVQSDYENNGFDSKPCAALAERAGEIMSEKDLSVVSDTILDIKSLNRTYIDDSGNTVEALKDFNLSVRHGEFVSVIGSSGCGKTTLLRLIAGLDKPESGELILGGEKITESNSECGYVFQQGSLFPWLTVEKNIAAGLKARKTYKENKDEVARYIELIGLKGFEKSFPHQISGGMAQRVAIARALINNPSVLLLDEPMGALDSFTRADIQDKLLELWKKNKITMILVTHDVDEAIYLSDRIVIMTPRPGRIEEIIEVDLPHPRHRGGPDFLSVRRNILEQLHLASANPQPEYMI
Sample Types
Isolate
34.0%
Metagenome
66.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
57.1%
Kalotermitidae
15.5%
Termitidae
11.9%
Unclassified
4.8%
Termopsidae
2.4%
Rhinotermitidae
2.4%
Largidae
2.4%
Hodotermitidae
1.2%
Culicidae
1.2%
Alydidae
1.2%
Taxonomy
Archaea
0
Bacteria
148
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 2 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 3 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 4 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 5 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 6 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 7 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 8 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 9 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 13 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 14 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 15 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 16 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 17 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 18 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 19 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 20 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 23 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 24 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 25 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 26 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 27 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 28 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 29 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 35 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 36 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 37 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 38 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 39 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 45 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 48 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 49 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 50 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 51 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 52 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 53 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 56 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 57 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 58 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 59 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 60 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 61 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 62 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 63 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 64 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 65 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 66 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 67 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 68 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 69 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 70 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 71 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 72 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 73 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 74 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 75 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 76 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 77 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 78 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 79 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 80 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 81 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 82 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 83 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 84 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 85 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 86 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 87 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_150221 | 3300042612 | Bacteria | 86975 |
| 2 | Ga0466715_104840 | 3300042616 | Bacteria | 52795 |
| 3 | Ga0466723_011551 | 3300042618 | Bacteria | 1999 |
| 4 | Ga0466723_115481 | 3300042618 | Bacteria | 4936 |
| 5 | Ga0466702_206903 | 3300042635 | Bacteria | 1532 |
| 6 | Ga0466704_368910 | 3300042643 | Bacteria | 3430 |
| 7 | Ga0466706_054914 | 3300042599 | Bacteria | 2944 |
| 8 | Ga0466706_126597 | 3300042599 | Unclassified | 4293 |
| 9 | Ga0466707_226883 | 3300042601 | Bacteria | 12333 |
| 10 | Ga0466707_242710 | 3300042601 | Bacteria | 58033 |
| 11 | Ga0466707_365176 | 3300042601 | Bacteria | 24343 |
| 12 | Ga0466692_054482 | 3300042591 | Bacteria | 5414 |
| 13 | Ga0466691_002442 | 3300042593 | Bacteria | 2327 |
| 14 | Ga0466691_091986 | 3300042593 | Bacteria | 6213 |
| 15 | Ga0466715_091750 | 3300042616 | Bacteria | 1462 |
| 16 | Ga0466708_091018 | 3300042652 | Bacteria | 13527 |
| 17 | Ga0466720_157973 | 3300042607 | Bacteria | 47409 |
| 18 | Ga0466691_112997 | 3300042593 | Bacteria | 11656 |
| 19 | Ga0466696_319752 | 3300042596 | Bacteria | 2034 |
| 20 | Ga0466699_178299 | 3300042597 | Bacteria | 1683 |
| 21 | Ga0466723_127301 | 3300042618 | Bacteria | 2061 |
| 22 | Ga0466728_153319 | 3300042620 | Bacteria | 1404 |
| 23 | Ga0466704_261828 | 3300042643 | Bacteria | 2098 |
| 24 | Ga0466716_087761 | 3300042605 | Unclassified | 1722 |
| 25 | JGI24695J34938_10002690 | 3300002450 | Unclassified | 13226 |
| 26 | Ga0072940_1062504 | 3300005200 | Bacteria | 2045 |
| 27 | Ga0072941_1018027 | 3300005201 | Bacteria | 4147 |
| 28 | Ga0466705_398769 | 3300042612 | Bacteria | 4196 |
| 29 | Ga0466718_055430 | 3300042617 | Bacteria | 2780 |
| 30 | Ga0466729_254863 | 3300042621 | Bacteria | 1635 |
| 31 | Ga0466735_205343 | 3300042624 | Bacteria | 4543 |
| 32 | Ga0466704_511759 | 3300042643 | Bacteria | 2594 |
| 33 | Ga0466708_131644 | 3300042652 | Bacteria | 25858 |
| 34 | Ga0466708_447156 | 3300042652 | Bacteria | 1110 |
| 35 | Ga0466706_044637 | 3300042599 | Bacteria | 9780 |
| 36 | Ga0466706_058010 | 3300042599 | Unclassified | 12190 |
| 37 | Ga0466716_509604 | 3300042605 | Bacteria | 3374 |
| 38 | Ga0466719_016752 | 3300042606 | Bacteria | 12242 |
| 39 | Ga0264413_114184 | 3300024493 | Bacteria | 5916 |
| 40 | JGI24698J34947_10037763 | 3300002449 | Bacteria | 2507 |
| 41 | Ga0072940_1070613 | 3300005200 | Unclassified | 1993 |
| 42 | Ga0072940_1072960 | 3300005200 | Bacteria | 10195 |
| 43 | Ga0466732_077304 | 3300042656 | Bacteria | 10735 |
| 44 | Ga0466705_429034 | 3300042612 | Bacteria | 18519 |
| 45 | Ga0466704_216556 | 3300042643 | Bacteria | 3765 |
| 46 | Ga0466706_081639 | 3300042599 | Bacteria | 8806 |
| 47 | Ga0466706_146230 | 3300042599 | Bacteria | 17660 |
| 48 | Ga0466707_123128 | 3300042601 | Bacteria | 17349 |
| 49 | Ga0466719_084673 | 3300042606 | Bacteria | 14004 |
| 50 | Ga0160447_100145 | 3300012849 | Bacteria | 46838 |
| 51 | Ga0466690_148197 | 3300042590 | Bacteria | 3106 |
| 52 | Ga0466690_253780 | 3300042590 | Bacteria | 14570 |
| 53 | Ga0466692_151398 | 3300042591 | Bacteria | 3797 |
| 54 | Ga0466691_126222 | 3300042593 | Bacteria | 7693 |
| 55 | AustNasuHG_c1001297 | 3300000089 | Bacteria | 8966 |
| 56 | AustNasuHG_c1023709 | 3300000089 | Unclassified | 1954 |
| 57 | Ga0072940_1079750 | 3300005200 | Bacteria | 1081 |
| 58 | Ga0466705_050264 | 3300042612 | Bacteria | 29337 |
| 59 | Ga0466705_100613 | 3300042612 | Bacteria | 15441 |
| 60 | Ga0466705_330087 | 3300042612 | Bacteria | 2353 |
| 61 | Ga0466712_064359 | 3300042614 | Bacteria | 30896 |
| 62 | Ga0466726_101410 | 3300042619 | Bacteria | 18973 |
| 63 | Ga0466703_284335 | 3300042636 | Bacteria | 61018 |
| 64 | Ga0466706_003511 | 3300042599 | Bacteria | 17419 |
| 65 | Ga0466707_151613 | 3300042601 | Bacteria | 21614 |
| 66 | Ga0466707_203663 | 3300042601 | Bacteria | 8514 |
| 67 | Ga0466707_316922 | 3300042601 | Unclassified | 11352 |
| 68 | Ga0466716_119392 | 3300042605 | Bacteria | 10651 |
| 69 | Ga0160464_100031 | 3300012805 | Unclassified | 183619 |
| 70 | Ga0264413_106792 | 3300024493 | Bacteria | 16840 |
| 71 | Ga0466691_205492 | 3300042593 | Bacteria | 27947 |
| 72 | AustNasuHG_c1002736 | 3300000089 | Bacteria | 6360 |
| 73 | Ga0072941_1004943 | 3300005201 | Bacteria | 7537 |
| 74 | Ga0072941_1018050 | 3300005201 | Bacteria | 5271 |
| 75 | Ga0072941_1637611 | 3300005201 | Bacteria | 1092 |
| 76 | Ga0466705_125716 | 3300042612 | Bacteria | 17133 |
| 77 | Ga0466705_279769 | 3300042612 | Bacteria | 4895 |
| 78 | Ga0466711_175373 | 3300042615 | Bacteria | 43795 |
| 79 | Ga0466715_016775 | 3300042616 | Bacteria | 2748 |
| 80 | Ga0466715_078909 | 3300042616 | Bacteria | 5962 |
| 81 | Ga0466723_361791 | 3300042618 | Bacteria | 7384 |
| 82 | Ga0466702_134236 | 3300042635 | Bacteria | 3032 |
| 83 | Ga0466703_365217 | 3300042636 | Bacteria | 2423 |
| 84 | Ga0466704_031971 | 3300042643 | Bacteria | 18532 |
| 85 | JGI24698J34947_10035206 | 3300002449 | Bacteria | 2616 |
| 86 | Ga0072940_1000763 | 3300005200 | Unclassified | 25180 |
| 87 | Ga0072941_1001304 | 3300005201 | Bacteria | 41270 |
| 88 | Ga0466705_039037 | 3300042612 | Bacteria | 1833 |
| 89 | Ga0466711_289473 | 3300042615 | Bacteria | 11158 |
| 90 | Ga0466711_452016 | 3300042615 | Bacteria | 5031 |
| 91 | Ga0466726_006397 | 3300042619 | Bacteria | 12607 |
| 92 | Ga0466703_270421 | 3300042636 | Bacteria | 12464 |
| 93 | Ga0466706_089474 | 3300042599 | Unclassified | 12266 |
| 94 | Ga0466706_167758 | 3300042599 | Bacteria | 11028 |
| 95 | Ga0466707_235204 | 3300042601 | Unclassified | 3758 |
| 96 | Ga0466719_210166 | 3300042606 | Bacteria | 30261 |
| 97 | Ga0466719_384725 | 3300042606 | Bacteria | 5476 |
| 98 | Ga0466720_032036 | 3300042607 | Bacteria | 49795 |
| 99 | Ga0264413_122870 | 3300024493 | Bacteria | 4343 |
| 100 | Ga0466692_121427 | 3300042591 | Bacteria | 25585 |
| 101 | AustNasuHG_c1000505 | 3300000089 | Bacteria | 13660 |
| 102 | AustNasuHG_c1002648 | 3300000089 | Bacteria | 6467 |
| 103 | Ga0072940_1070794 | 3300005200 | Bacteria | 3840 |
| 104 | Ga0072941_1012053 | 3300005201 | Bacteria | 14304 |
| 105 | Ga0072941_1051496 | 3300005201 | Bacteria | 17683 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300000089 | AustNasuHG_c1002648 | AustNasuHG_10026487 | 232 |
| 2 | 3300024493 | Ga0264413_114184 | Ga0264413_1141843 | 239 |
| 3 | 3300012849 | Ga0160447_100145 | Ga0160447_1001458 | 244 |
| 4 | iso_pr_bacteria | 2778260935 | 2778345092 | 248 |
| 5 | iso_pr_bacteria | 2778260938 | 2778351486 | 248 |
| 6 | 3300002450 | JGI24695J34938_10002690 | JGI24695J34938_1000269013 | 249 |
| 7 | 3300042605 | Ga0466716_509604 | Ga0466716_509604_2361_3164 | 249 |
| 8 | 3300042621 | Ga0466729_254863 | Ga0466729_254863_215_970 | 251 |
| 9 | 3300042643 | Ga0466704_368910 | Ga0466704_368910_1129_1884 | 251 |
| 10 | 3300005201 | Ga0072941_1637611 | Ga0072941_16376112 | 256 |
| 11 | iso_pr_bacteria | 2597489944 | 2598062364 | 256 |
| 12 | iso_pr_bacteria | 8024037630 | 8024044025 | 256 |
| 13 | iso_pr_bacteria | 8025650824 | 8025656317 | 256 |
| 14 | iso_pr_bacteria | 8025658853 | 8025664061 | 256 |
| 15 | iso_pr_bacteria | 8025671076 | 8025676126 | 256 |
| 16 | iso_pr_bacteria | 8025678175 | 8025683600 | 256 |
| 17 | iso_pr_bacteria | 8025685901 | 8025691861 | 256 |
| 18 | iso_pr_bacteria | 8025694439 | 8025699799 | 256 |
| 19 | iso_pr_bacteria | 8025708040 | 8025712586 | 256 |
| 20 | iso_pr_bacteria | 8025716094 | 8025722128 | 256 |
| 21 | iso_pr_bacteria | 8025740903 | 8025747789 | 256 |
| 22 | iso_pr_bacteria | 8069748016 | 8069753633 | 256 |
| 23 | iso_pr_bacteria | 8069763219 | 8069770105 | 256 |
| 24 | iso_pr_bacteria | 8078130113 | 8078134797 | 256 |
| 25 | iso_pr_bacteria | 8101951471 | 8101958137 | 256 |
| 26 | iso_pr_bacteria | 8101960468 | 8101967182 | 256 |
| 27 | iso_pr_bacteria | 8101967387 | 8101973816 | 256 |
| 28 | iso_pr_bacteria | 8101974301 | 8101981039 | 256 |
| 29 | iso_pr_bacteria | 8101981714 | 8101987657 | 256 |
| 30 | iso_pr_bacteria | 8101988189 | 8101994085 | 256 |
| 31 | iso_pr_bacteria | 8101994502 | 8102000665 | 256 |
| 32 | iso_pr_bacteria | 8102001125 | 8102007201 | 256 |
| 33 | iso_pr_bacteria | 8102007614 | 8102014122 | 256 |
| 34 | iso_pr_bacteria | 8102014801 | 8102019497 | 256 |
| 35 | iso_pr_bacteria | 8102026984 | 8102033350 | 256 |
| 36 | iso_pr_bacteria | 8102033761 | 8102040600 | 256 |
| 37 | iso_pr_bacteria | 8102047609 | 8102054138 | 256 |
| 38 | iso_pr_bacteria | 8102067727 | 8102074537 | 256 |
| 39 | iso_pr_bacteria | 8102094248 | 8102099173 | 256 |
| 40 | iso_pr_bacteria | 8102102351 | 8102107405 | 256 |
| 41 | iso_pr_bacteria | 8102109360 | 8102114251 | 256 |
| 42 | iso_pr_bacteria | 8102117041 | 8102122017 | 256 |
| 43 | iso_pr_bacteria | 8102124461 | 8102129463 | 256 |
| 44 | iso_pr_bacteria | 8102131453 | 8102134536 | 256 |
| 45 | iso_pr_bacteria | 8102138357 | 8102143052 | 256 |
| 46 | iso_pr_bacteria | 8102186987 | 8102193018 | 256 |
| 47 | iso_pr_bacteria | 8102193924 | 8102198468 | 256 |
| 48 | iso_pr_bacteria | 8102208438 | 8102213931 | 256 |
| 49 | iso_pr_bacteria | 8102216467 | 8102221827 | 256 |
| 50 | iso_pr_bacteria | 8102223607 | 8102228657 | 256 |
| 51 | iso_pr_bacteria | 8102230706 | 8102236666 | 256 |
| 52 | iso_pr_bacteria | 8102239244 | 8102244667 | 256 |
| 53 | iso_pr_bacteria | 8102251710 | 8102256918 | 256 |
| 54 | iso_pr_bacteria | 8102264549 | 8102271626 | 256 |
| 55 | iso_pr_bacteria | 8102271933 | 8102279001 | 256 |
| 56 | iso_pr_bacteria | 8102279326 | 8102285860 | 256 |
| 57 | iso_pr_bacteria | 8102286609 | 8102292895 | 256 |
| 58 | iso_pr_bacteria | 8102312426 | 8102319204 | 256 |
| 59 | 3300012805 | Ga0160464_100031 | Ga0160464_100031158 | 257 |
| 60 | 3300042601 | Ga0466707_235204 | Ga0466707_235204_2107_2883 | 258 |
| 61 | 3300042607 | Ga0466720_157973 | Ga0466720_157973_25425_26201 | 258 |
| 62 | iso_pr_bacteria | 8069755105 | 8069759859 | 258 |
| 63 | 3300000089 | AustNasuHG_c1001297 | AustNasuHG_10012972 | 259 |
| 64 | 3300000089 | AustNasuHG_c1002736 | AustNasuHG_10027365 | 259 |
| 65 | 3300000089 | AustNasuHG_c1023709 | AustNasuHG_10237093 | 259 |
| 66 | 3300005200 | Ga0072940_1000763 | Ga0072940_10007633 | 259 |
| 67 | 3300005200 | Ga0072940_1070613 | Ga0072940_10706132 | 259 |
| 68 | 3300042597 | Ga0466699_178299 | Ga0466699_178299_510_1289 | 259 |
| 69 | 3300042605 | Ga0466716_119392 | Ga0466716_119392_5123_5902 | 259 |
| 70 | 3300042635 | Ga0466702_134236 | Ga0466702_134236_1199_1978 | 259 |
| 71 | iso_pr_bacteria | 2989309576 | 2989310197 | 259 |
| 72 | 3300024493 | Ga0264413_106792 | Ga0264413_1067926 | 260 |
| 73 | 3300024493 | Ga0264413_122870 | Ga0264413_1228704 | 260 |
| 74 | 3300042593 | Ga0466691_091986 | Ga0466691_091986_2061_2843 | 260 |
| 75 | 3300042601 | Ga0466707_242710 | Ga0466707_242710_10339_11121 | 260 |
| 76 | 3300042601 | Ga0466707_365176 | Ga0466707_365176_18629_19411 | 260 |
| 77 | 3300042607 | Ga0466720_032036 | Ga0466720_032036_19030_19812 | 260 |
| 78 | 3300042612 | Ga0466705_039037 | Ga0466705_039037_426_1208 | 260 |
| 79 | 3300042617 | Ga0466718_055430 | Ga0466718_055430_357_1139 | 260 |
| 80 | 3300042636 | Ga0466703_365217 | Ga0466703_365217_1048_1830 | 260 |
| 81 | 3300042643 | Ga0466704_261828 | Ga0466704_261828_1238_2020 | 260 |
| 82 | 3300042652 | Ga0466708_447156 | Ga0466708_447156_92_874 | 260 |
| 83 | 3300002449 | JGI24698J34947_10035206 | JGI24698J34947_100352062 | 261 |
| 84 | 3300005200 | Ga0072940_1062504 | Ga0072940_10625042 | 261 |
| 85 | 3300005200 | Ga0072940_1070794 | Ga0072940_10707943 | 261 |
| 86 | 3300005200 | Ga0072940_1072960 | Ga0072940_10729606 | 261 |
| 87 | 3300005200 | Ga0072940_1079750 | Ga0072940_10797501 | 261 |
| 88 | 3300005201 | Ga0072941_1001304 | Ga0072941_100130419 | 261 |
| 89 | 3300042590 | Ga0466690_253780 | Ga0466690_253780_7649_8434 | 261 |
| 90 | 3300042591 | Ga0466692_121427 | Ga0466692_121427_19530_20315 | 261 |
| 91 | 3300042593 | Ga0466691_126222 | Ga0466691_126222_1483_2268 | 261 |
| 92 | 3300042606 | Ga0466719_384725 | Ga0466719_384725_1043_1924 | 261 |
| 93 | 3300042612 | Ga0466705_050264 | Ga0466705_050264_6435_7220 | 261 |
| 94 | 3300005201 | Ga0072941_1012053 | Ga0072941_10120535 | 262 |
| 95 | 3300005201 | Ga0072941_1018027 | Ga0072941_10180273 | 262 |
| 96 | 3300005201 | Ga0072941_1018050 | Ga0072941_10180503 | 262 |
| 97 | 3300042606 | Ga0466719_084673 | Ga0466719_084673_7232_8020 | 262 |
| 98 | 3300042616 | Ga0466715_016775 | Ga0466715_016775_1109_1897 | 262 |
| 99 | 3300042591 | Ga0466692_054482 | Ga0466692_054482_1924_2715 | 263 |
| 100 | 3300042591 | Ga0466692_151398 | Ga0466692_151398_940_1731 | 263 |
| 101 | 3300042593 | Ga0466691_205492 | Ga0466691_205492_19238_20032 | 264 |
| 102 | 3300042619 | Ga0466726_006397 | Ga0466726_006397_3937_4731 | 264 |
| 103 | 3300042619 | Ga0466726_101410 | Ga0466726_101410_10301_11095 | 264 |
| 104 | 3300042599 | Ga0466706_003511 | Ga0466706_003511_9814_10611 | 265 |
| 105 | 3300042599 | Ga0466706_044637 | Ga0466706_044637_241_1038 | 265 |
| 106 | 3300042599 | Ga0466706_054914 | Ga0466706_054914_1881_2678 | 265 |
| 107 | 3300042599 | Ga0466706_058010 | Ga0466706_058010_3664_4461 | 265 |
| 108 | 3300042599 | Ga0466706_089474 | Ga0466706_089474_5057_5854 | 265 |
| 109 | 3300042599 | Ga0466706_126597 | Ga0466706_126597_2884_3681 | 265 |
| 110 | 3300042599 | Ga0466706_146230 | Ga0466706_146230_11979_12776 | 265 |
| 111 | 3300042612 | Ga0466705_429034 | Ga0466705_429034_4885_5682 | 265 |
| 112 | 3300042643 | Ga0466704_216556 | Ga0466704_216556_2103_2900 | 265 |
| 113 | 3300042593 | Ga0466691_112997 | Ga0466691_112997_7330_8130 | 266 |
| 114 | 3300042612 | Ga0466705_330087 | Ga0466705_330087_1448_2248 | 266 |
| 115 | 3300042590 | Ga0466690_148197 | Ga0466690_148197_1967_2770 | 267 |
| 116 | 3300042614 | Ga0466712_064359 | Ga0466712_064359_29713_30516 | 267 |
| 117 | 3300042635 | Ga0466702_206903 | Ga0466702_206903_564_1367 | 267 |
| 118 | 3300042652 | Ga0466708_091018 | Ga0466708_091018_8492_9295 | 267 |
| 119 | 3300002449 | JGI24698J34947_10037763 | JGI24698J34947_100377632 | 268 |
| 120 | 3300005201 | Ga0072941_1004943 | Ga0072941_10049434 | 268 |
| 121 | 3300042593 | Ga0466691_002442 | Ga0466691_002442_757_1563 | 268 |
| 122 | 3300042596 | Ga0466696_319752 | Ga0466696_319752_599_1405 | 268 |
| 123 | 3300042612 | Ga0466705_398769 | Ga0466705_398769_2432_3238 | 268 |
| 124 | 3300042615 | Ga0466711_289473 | Ga0466711_289473_3740_4546 | 268 |
| 125 | 3300042618 | Ga0466723_011551 | Ga0466723_011551_1115_1921 | 268 |
| 126 | 3300042624 | Ga0466735_205343 | Ga0466735_205343_1248_2054 | 268 |
| 127 | 3300042643 | Ga0466704_511759 | Ga0466704_511759_961_1767 | 268 |
| 128 | 3300042656 | Ga0466732_077304 | Ga0466732_077304_1690_2496 | 268 |
| 129 | 3300005201 | Ga0072941_1051496 | Ga0072941_10514962 | 269 |
| 130 | 3300042620 | Ga0466728_153319 | Ga0466728_153319_157_966 | 269 |
| 131 | 3300042618 | Ga0466723_361791 | Ga0466723_361791_1760_2572 | 270 |
| 132 | 3300042618 | Ga0466723_115481 | Ga0466723_115481_4106_4921 | 271 |
| 133 | 3300000089 | AustNasuHG_c1000505 | AustNasuHG_100050512 | 272 |
| 134 | 3300042599 | Ga0466706_167758 | Ga0466706_167758_6654_7472 | 272 |
| 135 | 3300042606 | Ga0466719_210166 | Ga0466719_210166_5591_6451 | 274 |
| 136 | 3300042601 | Ga0466707_226883 | Ga0466707_226883_11222_12049 | 275 |
| 137 | 3300042601 | Ga0466707_151613 | Ga0466707_151613_5745_6575 | 276 |
| 138 | 3300042601 | Ga0466707_203663 | Ga0466707_203663_6493_7323 | 276 |
| 139 | 3300042616 | Ga0466715_104840 | Ga0466715_104840_2598_3428 | 276 |
| 140 | 3300042618 | Ga0466723_127301 | Ga0466723_127301_937_1770 | 277 |
| 141 | 3300042616 | Ga0466715_078909 | Ga0466715_078909_1037_1876 | 279 |
| 142 | 3300042615 | Ga0466711_175373 | Ga0466711_175373_42731_43573 | 280 |
| 143 | 3300042612 | Ga0466705_279769 | Ga0466705_279769_2501_3346 | 281 |
| 144 | 3300042612 | Ga0466705_100613 | Ga0466705_100613_6166_7014 | 282 |
| 145 | 3300042636 | Ga0466703_284335 | Ga0466703_284335_54445_55293 | 282 |
| 146 | 3300042601 | Ga0466707_316922 | Ga0466707_316922_9986_10837 | 283 |
| 147 | 3300042652 | Ga0466708_131644 | Ga0466708_131644_401_1255 | 284 |
| 148 | 3300042615 | Ga0466711_452016 | Ga0466711_452016_1242_2099 | 285 |
| 149 | iso_pr_bacteria | 3003878002 | 3003885844 | 285 |
| 150 | iso_pr_bacteria | 3003869270 | 3003877231 | 286 |
| 151 | 3300042612 | Ga0466705_125716 | Ga0466705_125716_10079_10948 | 289 |
| 152 | 3300042636 | Ga0466703_270421 | Ga0466703_270421_5610_6482 | 290 |
| 153 | 3300042601 | Ga0466707_123128 | Ga0466707_123128_15959_16834 | 291 |
| 154 | 3300042605 | Ga0466716_087761 | Ga0466716_087761_11_892 | 293 |
| 155 | 3300042612 | Ga0466705_150221 | Ga0466705_150221_47908_48987 | 303 |
| 156 | 3300042643 | Ga0466704_031971 | Ga0466704_031971_11620_12645 | 303 |
| 157 | 3300042606 | Ga0466719_016752 | Ga0466719_016752_7640_8557 | 305 |
| 158 | 3300042616 | Ga0466715_091750 | Ga0466715_091750_191_1111 | 306 |
| 159 | 3300042599 | Ga0466706_081639 | Ga0466706_081639_336_1268 | 310 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 76 | 214 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.79 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.