Protein Family IF05580
Metagenome
Isolate
184
Members
77
Samples
156
Scaffolds
141.78
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_049413|Ga0466706_049413_1734_2162
- Length
- 142 aa
- Sequence
- MPTINQQQDEIIAEFSDFDDWMDRYQLLIDLGNEQAPLDPQYKTEQNLIEGCQSRVWLQADETPDGTIVFQAESDALIVKGIVALLIRVLSGHTPDEILGADLYFIDRIGLREHLSPTRSNGLLAMVKQMRMYALAFKAKKG
Sample Types
Isolate
15.2%
Metagenome
84.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
32.0%
Termitidae
24.0%
Kalotermitidae
18.7%
Unclassified
6.7%
Rhinotermitidae
4.0%
Termopsidae
4.0%
Passalidae
2.7%
Armadillidiidae
2.7%
Drosophilidae
1.3%
Elmidae
1.3%
Formicidae
1.3%
Hodotermitidae
1.3%
Taxonomy
Archaea
1
Bacteria
181
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 8 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 11 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 12 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 13 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 14 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 15 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 16 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 17 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 18 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 22 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 29 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 30 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 31 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 32 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 39 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 40 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 41 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 42 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 43 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 44 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 45 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 46 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 47 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 48 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 49 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 54 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 55 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 56 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 57 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 58 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 59 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 60 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 61 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 62 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 63 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 64 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 65 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 66 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 67 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 68 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 69 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 70 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 71 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 72 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 73 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 74 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 75 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 76 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 77 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_11279403 | 3300010049 | Bacteria | 897 |
| 2 | Ga0466706_020667 | 3300042599 | Bacteria | 1712 |
| 3 | Ga0466706_106820 | 3300042599 | Bacteria | 11486 |
| 4 | Ga0466713_098438 | 3300042602 | Bacteria | 8563 |
| 5 | Ga0466719_428564 | 3300042606 | Bacteria | 11764 |
| 6 | Ga0466698_295370 | 3300042610 | Bacteria | 1136 |
| 7 | Ga0466690_004552 | 3300042590 | Bacteria | 6148 |
| 8 | Ga0466696_319649 | 3300042596 | Bacteria | 12317 |
| 9 | Ga0072941_1014371 | 3300005201 | Bacteria | 1524 |
| 10 | Ga0466705_173968 | 3300042612 | Bacteria | 9238 |
| 11 | Ga0466734_031042 | 3300042623 | Bacteria | 1177 |
| 12 | Ga0466735_124772 | 3300042624 | Bacteria | 3791 |
| 13 | Ga0466709_148866 | 3300042648 | Bacteria | 12054 |
| 14 | Ga0466727_196622 | 3300042655 | Bacteria | 2588 |
| 15 | Ga0466723_100368 | 3300042618 | Bacteria | 1324 |
| 16 | Ga0466726_024142 | 3300042619 | Bacteria | 22843 |
| 17 | Ga0123357_10025110 | 3300009784 | Bacteria | 8033 |
| 18 | Ga0123356_10339926 | 3300010049 | Bacteria | 1621 |
| 19 | Ga0466706_046564 | 3300042599 | Bacteria | 2178 |
| 20 | Ga0466706_109717 | 3300042599 | Bacteria | 38259 |
| 21 | Ga0466706_144986 | 3300042599 | Bacteria | 14894 |
| 22 | Ga0466706_239987 | 3300042599 | Bacteria | 1925 |
| 23 | Ga0466706_249816 | 3300042599 | Bacteria | 12942 |
| 24 | Ga0466707_221316 | 3300042601 | Bacteria | 4674 |
| 25 | Ga0466707_237717 | 3300042601 | Bacteria | 21796 |
| 26 | Ga0466707_399872 | 3300042601 | Bacteria | 25092 |
| 27 | Ga0466716_359991 | 3300042605 | Bacteria | 1905 |
| 28 | Ga0466719_070992 | 3300042606 | Bacteria | 21195 |
| 29 | Ga0160457_1004931 | 3300012858 | Bacteria | 2078 |
| 30 | Ga0466691_036107 | 3300042593 | Bacteria | 11902 |
| 31 | Ga0466696_175775 | 3300042596 | Bacteria | 6320 |
| 32 | JGI24699J35502_11133870 | 3300002509 | Bacteria | 17629 |
| 33 | JGI24696J40584_12416047 | 3300002834 | Bacteria | 561 |
| 34 | Ga0466705_242001 | 3300042612 | Bacteria | 3768 |
| 35 | Ga0466735_055144 | 3300042624 | Bacteria | 1814 |
| 36 | Ga0466735_067070 | 3300042624 | Bacteria | 4663 |
| 37 | Ga0466735_082084 | 3300042624 | Bacteria | 3045 |
| 38 | Ga0466704_338740 | 3300042643 | Bacteria | 1126 |
| 39 | Ga0466709_033872 | 3300042648 | Bacteria | 15123 |
| 40 | Ga0466727_247918 | 3300042655 | Bacteria | 10698 |
| 41 | Ga0466728_127567 | 3300042620 | Bacteria | 1100 |
| 42 | Ga0466706_222855 | 3300042599 | Bacteria | 3119 |
| 43 | Ga0466706_257671 | 3300042599 | Bacteria | 22850 |
| 44 | Ga0466707_240433 | 3300042601 | Bacteria | 1542 |
| 45 | Ga0160469_103519 | 3300012824 | Bacteria | 2132 |
| 46 | Ga0265387_1138588 | 3300024582 | Bacteria | 540 |
| 47 | Ga0466690_036554 | 3300042590 | Bacteria | 8294 |
| 48 | Ga0466692_118396 | 3300042591 | Bacteria | 17383 |
| 49 | Ga0466692_159828 | 3300042591 | Bacteria | 1510 |
| 50 | Ga0102740_1004361 | 3300007140 | Bacteria | 2822 |
| 51 | Ga0466705_372873 | 3300042612 | Bacteria | 2926 |
| 52 | Ga0466734_154017 | 3300042623 | Bacteria | 1775 |
| 53 | Ga0466735_153438 | 3300042624 | Bacteria | 10285 |
| 54 | Ga0466703_001080 | 3300042636 | Bacteria | 3254 |
| 55 | Ga0466704_096242 | 3300042643 | Bacteria | 7229 |
| 56 | Ga0466708_292277 | 3300042652 | Bacteria | 30652 |
| 57 | Ga0466711_338262 | 3300042615 | Bacteria | 2533 |
| 58 | Ga0466715_161819 | 3300042616 | Bacteria | 3799 |
| 59 | Ga0466715_281872 | 3300042616 | Bacteria | 2886 |
| 60 | Ga0466728_240734 | 3300042620 | Bacteria | 10927 |
| 61 | Ga0466733_102603 | 3300042659 | Bacteria | 1083 |
| 62 | Ga0123356_10008094 | 3300010049 | Bacteria | 10469 |
| 63 | Ga0123356_12233386 | 3300010049 | Bacteria | 684 |
| 64 | Ga0466706_242401 | 3300042599 | Bacteria | 7115 |
| 65 | Ga0466700_051149 | 3300042600 | Bacteria | 14467 |
| 66 | Ga0466700_327334 | 3300042600 | Bacteria | 6607 |
| 67 | Ga0466707_042066 | 3300042601 | Bacteria | 33916 |
| 68 | Ga0466707_048206 | 3300042601 | Bacteria | 20502 |
| 69 | Ga0466707_074552 | 3300042601 | Bacteria | 9882 |
| 70 | Ga0466713_020362 | 3300042602 | Bacteria | 2140 |
| 71 | Ga0466713_022249 | 3300042602 | Bacteria | 5612 |
| 72 | Ga0466713_054436 | 3300042602 | Bacteria | 5042 |
| 73 | Ga0466719_146195 | 3300042606 | Bacteria | 9170 |
| 74 | Ga0466656_002043 | 3300042550 | Bacteria | 1477 |
| 75 | Ga0466690_027002 | 3300042590 | Bacteria | 12377 |
| 76 | Ga0466696_014961 | 3300042596 | Bacteria | 77550 |
| 77 | Ga0466696_060564 | 3300042596 | Bacteria | 15490 |
| 78 | 2227436347 | 2225789004 | Bacteria | 5525 |
| 79 | IMNBL1DRAFT_c0001032 | 3300000062 | Bacteria | 21563 |
| 80 | JGI24702J35022_10016312 | 3300002462 | Bacteria | 4072 |
| 81 | Ga0068305_10002064 | 3300005083 | Bacteria | 156822 |
| 82 | Ga0466734_149966 | 3300042623 | Bacteria | 1529 |
| 83 | Ga0466703_076149 | 3300042636 | Bacteria | 7100 |
| 84 | Ga0466703_116882 | 3300042636 | Bacteria | 19357 |
| 85 | Ga0466709_207018 | 3300042648 | Bacteria | 42287 |
| 86 | Ga0466728_082958 | 3300042620 | Bacteria | 1758 |
| 87 | Ga0466706_012196 | 3300042599 | Bacteria | 6835 |
| 88 | Ga0466706_153678 | 3300042599 | Unclassified | 4958 |
| 89 | Ga0466707_282164 | 3300042601 | Bacteria | 1329 |
| 90 | Ga0466713_095333 | 3300042602 | Bacteria | 7204 |
| 91 | Ga0466713_130834 | 3300042602 | Bacteria | 31381 |
| 92 | Ga0466716_120561 | 3300042605 | Bacteria | 8833 |
| 93 | Ga0466716_327739 | 3300042605 | Bacteria | 1182 |
| 94 | Ga0466719_148955 | 3300042606 | Bacteria | 4231 |
| 95 | Ga0466722_263219 | 3300042609 | Bacteria | 3160 |
| 96 | Ga0466693_182448 | 3300042592 | Bacteria | 1340 |
| 97 | Ga0466696_068608 | 3300042596 | Bacteria | 11435 |
| 98 | JGI24702J35022_10147750 | 3300002462 | Bacteria | 1316 |
| 99 | Ga0068305_10028206 | 3300005083 | Bacteria | 9775 |
| 100 | Ga0068305_10258562 | 3300005083 | Bacteria | 2524 |
| 101 | Ga0072941_1630303 | 3300005201 | Bacteria | 2915 |
| 102 | Ga0466705_015792 | 3300042612 | Bacteria | 1696 |
| 103 | Ga0466705_387234 | 3300042612 | Unclassified | 2517 |
| 104 | Ga0466734_149046 | 3300042623 | Bacteria | 1462 |
| 105 | Ga0466735_046740 | 3300042624 | Bacteria | 2183 |
| 106 | Ga0466735_215593 | 3300042624 | Bacteria | 1022 |
| 107 | Ga0466703_264743 | 3300042636 | Bacteria | 19401 |
| 108 | Ga0466704_125583 | 3300042643 | Bacteria | 27979 |
| 109 | Ga0466704_554600 | 3300042643 | Bacteria | 11294 |
| 110 | Ga0466715_128031 | 3300042616 | Bacteria | 13792 |
| 111 | Ga0466715_405993 | 3300042616 | Bacteria | 2479 |
| 112 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 113 | Ga0466706_049413 | 3300042599 | Bacteria | 18222 |
| 114 | Ga0466707_094550 | 3300042601 | Bacteria | 1302 |
| 115 | Ga0466713_048382 | 3300042602 | Bacteria | 34052 |
| 116 | Ga0466656_020661 | 3300042550 | Bacteria | 5276 |
| 117 | Ga0466691_091359 | 3300042593 | Bacteria | 169365 |
| 118 | IMNBL1DRAFT_c0020149 | 3300000062 | Bacteria | 2709 |
| 119 | Ga0068305_10111749 | 3300005083 | Bacteria | 2628 |
| 120 | Ga0104041_1034016 | 3300007106 | Bacteria | 1114 |
| 121 | Ga0466697_251672 | 3300042611 | Bacteria | 1160 |
| 122 | Ga0466735_061198 | 3300042624 | Bacteria | 8328 |
| 123 | Ga0466735_133056 | 3300042624 | Bacteria | 5271 |
| 124 | Ga0466725_163341 | 3300042654 | Bacteria | 17426 |
| 125 | Ga0466727_290245 | 3300042655 | Bacteria | 1717 |
| 126 | Ga0466710_410632 | 3300042613 | Bacteria | 1588 |
| 127 | Ga0466711_264721 | 3300042615 | Bacteria | 26624 |
| 128 | Ga0466715_309209 | 3300042616 | Bacteria | 44379 |
| 129 | Ga0466723_203812 | 3300042618 | Bacteria | 4824 |
| 130 | Ga0123356_12183752 | 3300010049 | Archaea | 692 |
| 131 | Ga0123354_10031632 | 3300010882 | Bacteria | 8298 |
| 132 | Ga0466701_050869 | 3300042598 | Bacteria | 17554 |
| 133 | Ga0466706_041421 | 3300042599 | Bacteria | 6658 |
| 134 | Ga0466706_166563 | 3300042599 | Bacteria | 29380 |
| 135 | Ga0466707_071134 | 3300042601 | Bacteria | 13094 |
| 136 | Ga0466707_130524 | 3300042601 | Bacteria | 6372 |
| 137 | Ga0466713_101553 | 3300042602 | Bacteria | 8041 |
| 138 | Ga0466714_062274 | 3300042603 | Bacteria | 5640 |
| 139 | Ga0466722_035273 | 3300042609 | Bacteria | 4272 |
| 140 | Ga0466722_084732 | 3300042609 | Bacteria | 2145 |
| 141 | Ga0466692_032866 | 3300042591 | Bacteria | 37963 |
| 142 | Ga0466705_050950 | 3300042612 | Bacteria | 13509 |
| 143 | Ga0466735_103100 | 3300042624 | Bacteria | 5686 |
| 144 | Ga0466735_108542 | 3300042624 | Bacteria | 12812 |
| 145 | Ga0466735_197679 | 3300042624 | Bacteria | 1448 |
| 146 | Ga0466723_108832 | 3300042618 | Bacteria | 7789 |
| 147 | Ga0466728_098945 | 3300042620 | Bacteria | 3978 |
| 148 | Ga0466706_021030 | 3300042599 | Bacteria | 4406 |
| 149 | Ga0466707_044398 | 3300042601 | Bacteria | 37204 |
| 150 | Ga0466716_043611 | 3300042605 | Bacteria | 1496 |
| 151 | Ga0466716_487732 | 3300042605 | Bacteria | 16500 |
| 152 | IMNBL1DRAFT_c0000100 | 3300000062 | Bacteria | 75970 |
| 153 | Ga0466705_005625 | 3300042612 | Bacteria | 36078 |
| 154 | Ga0466731_008464 | 3300042622 | Bacteria | 2300 |
| 155 | Ga0466727_165334 | 3300042655 | Bacteria | 3349 |
| 156 | Ga0466710_297519 | 3300042613 | Bacteria | 2193 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042623 | Ga0466734_149046 | Ga0466734_149046_107_502 | 131 |
| 2 | 3300042624 | Ga0466735_197679 | Ga0466735_197679_46_441 | 131 |
| 3 | 3300002462 | JGI24702J35022_10016312 | JGI24702J35022_100163123 | 137 |
| 4 | 3300042613 | Ga0466710_297519 | Ga0466710_297519_286_699 | 137 |
| 5 | 3300010882 | Ga0123354_10031632 | Ga0123354_100316324 | 138 |
| 6 | 3300042550 | Ga0466656_020661 | Ga0466656_020661_2851_3267 | 138 |
| 7 | 3300042609 | Ga0466722_084732 | Ga0466722_084732_839_1255 | 138 |
| 8 | 3300042612 | Ga0466705_372873 | Ga0466705_372873_2201_2617 | 138 |
| 9 | 3300042643 | Ga0466704_125583 | Ga0466704_125583_2771_3187 | 138 |
| 10 | 3300024582 | Ga0265387_1138588 | Ga0265387_11385881 | 139 |
| 11 | 3300042590 | Ga0466690_027002 | Ga0466690_027002_6614_7033 | 139 |
| 12 | 3300042590 | Ga0466690_036554 | Ga0466690_036554_2642_3061 | 139 |
| 13 | 3300042593 | Ga0466691_036107 | Ga0466691_036107_10275_10694 | 139 |
| 14 | 3300042596 | Ga0466696_060564 | Ga0466696_060564_11207_11626 | 139 |
| 15 | 3300042598 | Ga0466701_050869 | Ga0466701_050869_669_1088 | 139 |
| 16 | 3300042599 | Ga0466706_020667 | Ga0466706_020667_244_663 | 139 |
| 17 | 3300042599 | Ga0466706_041421 | Ga0466706_041421_3496_3915 | 139 |
| 18 | 3300042599 | Ga0466706_046564 | Ga0466706_046564_1729_2148 | 139 |
| 19 | 3300042599 | Ga0466706_109717 | Ga0466706_109717_29487_29906 | 139 |
| 20 | 3300042599 | Ga0466706_153678 | Ga0466706_153678_2182_2601 | 139 |
| 21 | 3300042599 | Ga0466706_242401 | Ga0466706_242401_1549_1968 | 139 |
| 22 | 3300042600 | Ga0466700_327334 | Ga0466700_327334_2275_2694 | 139 |
| 23 | 3300042601 | Ga0466707_221316 | Ga0466707_221316_3869_4288 | 139 |
| 24 | 3300042602 | Ga0466713_130834 | Ga0466713_130834_29184_29603 | 139 |
| 25 | 3300042605 | Ga0466716_120561 | Ga0466716_120561_8335_8754 | 139 |
| 26 | 3300042605 | Ga0466716_487732 | Ga0466716_487732_4245_4664 | 139 |
| 27 | 3300042612 | Ga0466705_387234 | Ga0466705_387234_1607_2026 | 139 |
| 28 | 3300042618 | Ga0466723_203812 | Ga0466723_203812_3316_3735 | 139 |
| 29 | 3300042619 | Ga0466726_024142 | Ga0466726_024142_563_982 | 139 |
| 30 | 3300042620 | Ga0466728_098945 | Ga0466728_098945_124_543 | 139 |
| 31 | 3300042620 | Ga0466728_127567 | Ga0466728_127567_253_672 | 139 |
| 32 | 3300042624 | Ga0466735_108542 | Ga0466735_108542_10240_10659 | 139 |
| 33 | 3300042648 | Ga0466709_033872 | Ga0466709_033872_9078_9497 | 139 |
| 34 | 3300042659 | Ga0466733_102603 | Ga0466733_102603_564_983 | 139 |
| 35 | iso_pr_bacteria | 2820762746 | 2820763418 | 139 |
| 36 | iso_pr_bacteria | 2864836148 | 2864837127 | 139 |
| 37 | iso_pr_bacteria | 2922326829 | 2922327861 | 139 |
| 38 | iso_pr_bacteria | 3004667792 | 3004671327 | 139 |
| 39 | 3300002462 | JGI24702J35022_10147750 | JGI24702J35022_101477502 | 140 |
| 40 | 3300002509 | JGI24699J35502_11133870 | JGI24699J35502_1113387016 | 140 |
| 41 | 3300005083 | Ga0068305_10028206 | Ga0068305_100282069 | 140 |
| 42 | 3300005201 | Ga0072941_1630303 | Ga0072941_16303032 | 140 |
| 43 | 3300042596 | Ga0466696_319649 | Ga0466696_319649_5785_6207 | 140 |
| 44 | 3300042599 | Ga0466706_012196 | Ga0466706_012196_3336_3758 | 140 |
| 45 | 3300042600 | Ga0466700_051149 | Ga0466700_051149_10385_10807 | 140 |
| 46 | 3300042601 | Ga0466707_130524 | Ga0466707_130524_4560_4982 | 140 |
| 47 | 3300042601 | Ga0466707_237717 | Ga0466707_237717_11388_11810 | 140 |
| 48 | 3300042602 | Ga0466713_022249 | Ga0466713_022249_3660_4082 | 140 |
| 49 | 3300042602 | Ga0466713_054436 | Ga0466713_054436_1435_1857 | 140 |
| 50 | 3300042606 | Ga0466719_146195 | Ga0466719_146195_2688_3110 | 140 |
| 51 | 3300042611 | Ga0466697_251672 | Ga0466697_251672_184_606 | 140 |
| 52 | 3300042615 | Ga0466711_338262 | Ga0466711_338262_1595_2017 | 140 |
| 53 | 3300042616 | Ga0466715_128031 | Ga0466715_128031_4782_5204 | 140 |
| 54 | 3300042616 | Ga0466715_161819 | Ga0466715_161819_3048_3470 | 140 |
| 55 | 3300042616 | Ga0466715_309209 | Ga0466715_309209_7921_8343 | 140 |
| 56 | 3300042620 | Ga0466728_082958 | Ga0466728_082958_1324_1746 | 140 |
| 57 | 3300042620 | Ga0466728_240734 | Ga0466728_240734_9259_9681 | 140 |
| 58 | 3300042623 | Ga0466734_031042 | Ga0466734_031042_431_853 | 140 |
| 59 | 3300042623 | Ga0466734_154017 | Ga0466734_154017_35_457 | 140 |
| 60 | 3300042624 | Ga0466735_067070 | Ga0466735_067070_2585_3007 | 140 |
| 61 | 3300042624 | Ga0466735_124772 | Ga0466735_124772_1748_2170 | 140 |
| 62 | 3300042624 | Ga0466735_153438 | Ga0466735_153438_8888_9310 | 140 |
| 63 | 3300042624 | Ga0466735_215593 | Ga0466735_215593_111_533 | 140 |
| 64 | 3300042636 | Ga0466703_076149 | Ga0466703_076149_4990_5412 | 140 |
| 65 | 3300042648 | Ga0466709_207018 | Ga0466709_207018_11630_12052 | 140 |
| 66 | 3300042654 | Ga0466725_163341 | Ga0466725_163341_7008_7430 | 140 |
| 67 | 3300042655 | Ga0466727_196622 | Ga0466727_196622_423_845 | 140 |
| 68 | 3300042655 | Ga0466727_247918 | Ga0466727_247918_4995_5417 | 140 |
| 69 | 3300042659 | Ga0466733_038286 | Ga0466733_038286_143572_143994 | 140 |
| 70 | iso_pr_bacteria | 2923982719 | 2923982814 | 140 |
| 71 | iso_pr_bacteria | 2940193328 | 2940195072 | 140 |
| 72 | iso_pr_bacteria | 2940336608 | 2940338347 | 140 |
| 73 | iso_pr_bacteria | 2940371297 | 2940373221 | 140 |
| 74 | iso_pr_bacteria | 3004677695 | 3004677796 | 140 |
| 75 | 2225789004 | 2227436347 | 2227875158 | 141 |
| 76 | 3300000062 | IMNBL1DRAFT_c0001032 | IMNBL1DRAFT_00010327 | 141 |
| 77 | 3300005083 | Ga0068305_10002064 | Ga0068305_100020649 | 141 |
| 78 | 3300005201 | Ga0072941_1014371 | Ga0072941_10143713 | 141 |
| 79 | 3300010049 | Ga0123356_10008094 | Ga0123356_100080947 | 141 |
| 80 | 3300010049 | Ga0123356_11279403 | Ga0123356_112794032 | 141 |
| 81 | 3300012824 | Ga0160469_103519 | Ga0160469_1035193 | 141 |
| 82 | 3300012858 | Ga0160457_1004931 | Ga0160457_10049313 | 141 |
| 83 | 3300042591 | Ga0466692_032866 | Ga0466692_032866_7600_8025 | 141 |
| 84 | 3300042599 | Ga0466706_239987 | Ga0466706_239987_624_1049 | 141 |
| 85 | 3300042601 | Ga0466707_044398 | Ga0466707_044398_7920_8345 | 141 |
| 86 | 3300042602 | Ga0466713_020362 | Ga0466713_020362_912_1337 | 141 |
| 87 | 3300042602 | Ga0466713_095333 | Ga0466713_095333_3237_3662 | 141 |
| 88 | 3300042603 | Ga0466714_062274 | Ga0466714_062274_382_807 | 141 |
| 89 | 3300042605 | Ga0466716_359991 | Ga0466716_359991_884_1309 | 141 |
| 90 | 3300042606 | Ga0466719_070992 | Ga0466719_070992_3794_4219 | 141 |
| 91 | 3300042609 | Ga0466722_035273 | Ga0466722_035273_2775_3200 | 141 |
| 92 | 3300042609 | Ga0466722_263219 | Ga0466722_263219_2066_2491 | 141 |
| 93 | 3300042612 | Ga0466705_005625 | Ga0466705_005625_3038_3463 | 141 |
| 94 | 3300042612 | Ga0466705_242001 | Ga0466705_242001_2109_2534 | 141 |
| 95 | 3300042616 | Ga0466715_281872 | Ga0466715_281872_1982_2407 | 141 |
| 96 | 3300042623 | Ga0466734_149966 | Ga0466734_149966_999_1424 | 141 |
| 97 | 3300042624 | Ga0466735_046740 | Ga0466735_046740_1310_1735 | 141 |
| 98 | 3300042624 | Ga0466735_055144 | Ga0466735_055144_54_479 | 141 |
| 99 | 3300042624 | Ga0466735_082084 | Ga0466735_082084_384_809 | 141 |
| 100 | 3300042636 | Ga0466703_001080 | Ga0466703_001080_2098_2523 | 141 |
| 101 | iso_pr_bacteria | 2940199050 | 2940199737 | 141 |
| 102 | iso_pr_bacteria | 2940209341 | 2940212341 | 141 |
| 103 | iso_pr_bacteria | 2940346213 | 2940348862 | 141 |
| 104 | 3300000062 | IMNBL1DRAFT_c0020149 | IMNBL1DRAFT_00201493 | 142 |
| 105 | 3300005083 | Ga0068305_10111749 | Ga0068305_101117492 | 142 |
| 106 | 3300005083 | Ga0068305_10258562 | Ga0068305_102585623 | 142 |
| 107 | 3300010049 | Ga0123356_12233386 | Ga0123356_122333862 | 142 |
| 108 | 3300042550 | Ga0466656_002043 | Ga0466656_002043_719_1147 | 142 |
| 109 | 3300042590 | Ga0466690_004552 | Ga0466690_004552_3065_3493 | 142 |
| 110 | 3300042592 | Ga0466693_182448 | Ga0466693_182448_804_1232 | 142 |
| 111 | 3300042596 | Ga0466696_014961 | Ga0466696_014961_64544_64972 | 142 |
| 112 | 3300042599 | Ga0466706_049413 | Ga0466706_049413_1734_2162 | 142 |
| 113 | 3300042599 | Ga0466706_106820 | Ga0466706_106820_10642_11070 | 142 |
| 114 | 3300042599 | Ga0466706_166563 | Ga0466706_166563_6976_7404 | 142 |
| 115 | 3300042601 | Ga0466707_071134 | Ga0466707_071134_4907_5335 | 142 |
| 116 | 3300042601 | Ga0466707_074552 | Ga0466707_074552_4360_4788 | 142 |
| 117 | 3300042601 | Ga0466707_094550 | Ga0466707_094550_361_789 | 142 |
| 118 | 3300042602 | Ga0466713_098438 | Ga0466713_098438_862_1290 | 142 |
| 119 | 3300042602 | Ga0466713_101553 | Ga0466713_101553_2213_2641 | 142 |
| 120 | 3300042612 | Ga0466705_015792 | Ga0466705_015792_275_703 | 142 |
| 121 | 3300042612 | Ga0466705_050950 | Ga0466705_050950_8969_9397 | 142 |
| 122 | 3300042622 | Ga0466731_008464 | Ga0466731_008464_1711_2139 | 142 |
| 123 | 3300042624 | Ga0466735_061198 | Ga0466735_061198_5118_5546 | 142 |
| 124 | 3300042624 | Ga0466735_103100 | Ga0466735_103100_3933_4361 | 142 |
| 125 | 3300042636 | Ga0466703_116882 | Ga0466703_116882_5422_5850 | 142 |
| 126 | 3300042643 | Ga0466704_338740 | Ga0466704_338740_230_658 | 142 |
| 127 | 3300042652 | Ga0466708_292277 | Ga0466708_292277_29263_29691 | 142 |
| 128 | 3300042655 | Ga0466727_165334 | Ga0466727_165334_1681_2109 | 142 |
| 129 | iso_pr_bacteria | 2910926975 | 2910927405 | 142 |
| 130 | iso_pr_bacteria | 2940202316 | 2940204720 | 142 |
| 131 | iso_pr_bacteria | 2940205530 | 2940206166 | 142 |
| 132 | iso_pr_bacteria | 2940212447 | 2940213081 | 142 |
| 133 | iso_pr_bacteria | 2940298504 | 2940299137 | 142 |
| 134 | iso_pr_bacteria | 2940302308 | 2940302790 | 142 |
| 135 | iso_pr_bacteria | 2940306115 | 2940306198 | 142 |
| 136 | iso_pr_bacteria | 2940309933 | 2940310168 | 142 |
| 137 | iso_pr_bacteria | 2940313741 | 2940313978 | 142 |
| 138 | iso_pr_bacteria | 2940317558 | 2940317641 | 142 |
| 139 | iso_pr_bacteria | 2940321370 | 2940321606 | 142 |
| 140 | iso_pr_bacteria | 2940325180 | 2940325662 | 142 |
| 141 | iso_pr_bacteria | 2940328985 | 2940329468 | 142 |
| 142 | iso_pr_bacteria | 2940332795 | 2940332878 | 142 |
| 143 | 3300002834 | JGI24696J40584_12416047 | JGI24696J40584_124160471 | 143 |
| 144 | 3300010049 | Ga0123356_12183752 | Ga0123356_121837522 | 143 |
| 145 | 3300042591 | Ga0466692_159828 | Ga0466692_159828_884_1315 | 143 |
| 146 | 3300042599 | Ga0466706_021030 | Ga0466706_021030_2147_2578 | 143 |
| 147 | 3300042599 | Ga0466706_257671 | Ga0466706_257671_12857_13288 | 143 |
| 148 | 3300042601 | Ga0466707_042066 | Ga0466707_042066_1753_2184 | 143 |
| 149 | 3300042601 | Ga0466707_240433 | Ga0466707_240433_842_1273 | 143 |
| 150 | 3300042601 | Ga0466707_282164 | Ga0466707_282164_190_621 | 143 |
| 151 | 3300042606 | Ga0466719_428564 | Ga0466719_428564_10745_11176 | 143 |
| 152 | 3300042610 | Ga0466698_295370 | Ga0466698_295370_201_632 | 143 |
| 153 | 3300042616 | Ga0466715_405993 | Ga0466715_405993_1912_2343 | 143 |
| 154 | 3300042618 | Ga0466723_100368 | Ga0466723_100368_82_513 | 143 |
| 155 | 3300042624 | Ga0466735_133056 | Ga0466735_133056_2771_3202 | 143 |
| 156 | iso_pr_bacteria | 2609459943 | 2610743643 | 143 |
| 157 | iso_pr_bacteria | 2830041218 | 2830045071 | 143 |
| 158 | 3300009784 | Ga0123357_10025110 | Ga0123357_100251103 | 144 |
| 159 | 3300010049 | Ga0123356_10339926 | Ga0123356_103399262 | 144 |
| 160 | 3300042599 | Ga0466706_222855 | Ga0466706_222855_1963_2397 | 144 |
| 161 | 3300042601 | Ga0466707_048206 | Ga0466707_048206_1890_2324 | 144 |
| 162 | 3300042605 | Ga0466716_043611 | Ga0466716_043611_261_695 | 144 |
| 163 | 3300042605 | Ga0466716_327739 | Ga0466716_327739_448_882 | 144 |
| 164 | 3300042618 | Ga0466723_108832 | Ga0466723_108832_2420_2854 | 144 |
| 165 | 3300000062 | IMNBL1DRAFT_c0000100 | IMNBL1DRAFT_000010024 | 145 |
| 166 | 3300042596 | Ga0466696_175775 | Ga0466696_175775_4782_5219 | 145 |
| 167 | 3300042599 | Ga0466706_144986 | Ga0466706_144986_354_791 | 145 |
| 168 | 3300042655 | Ga0466727_290245 | Ga0466727_290245_652_1089 | 145 |
| 169 | 3300042591 | Ga0466692_118396 | Ga0466692_118396_16028_16468 | 146 |
| 170 | 3300042606 | Ga0466719_148955 | Ga0466719_148955_3726_4166 | 146 |
| 171 | 3300042643 | Ga0466704_096242 | Ga0466704_096242_501_941 | 146 |
| 172 | 3300042596 | Ga0466696_068608 | Ga0466696_068608_7590_8033 | 147 |
| 173 | 3300042643 | Ga0466704_554600 | Ga0466704_554600_7798_8241 | 147 |
| 174 | 3300007106 | Ga0104041_1034016 | Ga0104041_10340162 | 148 |
| 175 | 3300042612 | Ga0466705_173968 | Ga0466705_173968_1493_1939 | 148 |
| 176 | 3300042602 | Ga0466713_048382 | Ga0466713_048382_16028_16477 | 149 |
| 177 | 3300042648 | Ga0466709_148866 | Ga0466709_148866_89_538 | 149 |
| 178 | 3300042636 | Ga0466703_264743 | Ga0466703_264743_1867_2319 | 150 |
| 179 | 3300042599 | Ga0466706_249816 | Ga0466706_249816_11460_11915 | 151 |
| 180 | 3300042593 | Ga0466691_091359 | Ga0466691_091359_85486_85944 | 152 |
| 181 | 3300042601 | Ga0466707_399872 | Ga0466707_399872_6197_6661 | 154 |
| 182 | 3300042615 | Ga0466711_264721 | Ga0466711_264721_8360_8824 | 154 |
| 183 | 3300042613 | Ga0466710_410632 | Ga0466710_410632_951_1427 | 158 |
| 184 | 3300007140 | Ga0102740_1004361 | Ga0102740_10043612 | 186 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02657 | SufE | Fe-S metabolism associated domain | 13 | 132 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.9 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.