Protein Family IF05567

Metagenome Isolate
199 Members
101 Samples
165 Scaffolds
414.98 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_025174|Ga0466706_025174_40080_41513
Length
460 aa
Sequence
MKLILSLYIIRKYFANLLIYFKGIYILHQEERVVKSGLRNNISIRQEFFVNLLHLYSNNDWVCDMNTVEIITIGDEILIGQIVDTNSAWIAKELNKEGFKIIRITSIPDKQEDILDAFESAFKHADIVLVTGGIGPTKDDITKQTLCKYFRAEMVFNEDAYQNVLRQIADRPNAMNRLTRDQAYVPSTCIPIMNRVGTAPITWFEQDGKVLVSMPGVPEEMKWAIQHEILPRIKAHFQTPQLRHQTIIVQGNAESQLALKLEEWEDNLPAYIKLAYLPQAAFVRLRLTGQHADKEFLENTIRKKVKELKEILGKDVSKGLTFATAESCTGGNIARLMTSHPGSSHFFNGSVIAYSNEVKENVLGVNHADIERYGAVSETVVKQMVSGAGKLLNADIVVATSGIAGPEGGTEEKPVGTVWIAAGNAAKVIARKYQFGNSRKRNIEKATYAAIFLVKEFVEE

📊 Sample Types

Isolate 17.1%
Metagenome 82.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 24.5%
Unclassified 16.0%
Kalotermitidae 13.8%
Blattidae 9.6%
Armadillidiidae 6.4%
Rhinotermitidae 4.3%
Termopsidae 4.3%
Culicidae 4.3%
Hydrophilidae 3.2%
Drosophilidae 3.2%
Daphniidae 2.1%
Tenebrionidae 2.1%
Elmidae 2.1%
Passalidae 2.1%
Nephropidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 194
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
2 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
3 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
4 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
14 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
15 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
16 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
17 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
18 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
19 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
20 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
21 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
22 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
23 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
24 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
25 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
29 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
30 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
31 2920168565 Paludibacter sp. 221 Isolate Blattidae
32 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
33 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
34 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
36 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
37 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
38 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
39 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
40 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
41 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
44 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
50 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
51 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
52 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
53 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
54 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
55 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
56 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
57 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
58 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
59 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
60 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
61 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
62 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
64 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
65 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
66 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
67 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
68 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
69 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
70 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
71 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
72 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
73 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
74 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
75 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
76 2882250448 Bizionia sp. APA-3 Isolate
77 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
78 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
79 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
80 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
81 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
82 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
83 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
84 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
85 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
86 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
87 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
88 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
89 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
90 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
91 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
92 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
93 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
94 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
95 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
96 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
97 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
98 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
99 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
100 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
101 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_289260 3300042612 Bacteria 9143
2 Ga0466705_310929 3300042612 Bacteria 9190
3 Ga0466733_157382 3300042659 Bacteria 9443
4 Ga0466733_174420 3300042659 Bacteria 8101
5 Ga0466715_301846 3300042616 Bacteria 6113
6 Ga0466723_013453 3300042618 Bacteria 5349
7 Ga0466726_049641 3300042619 Bacteria 4451
8 Ga0466726_474730 3300042619 Bacteria 3872
9 Ga0466728_327686 3300042620 Bacteria 44532
10 Ga0160468_100062 3300012819 Bacteria 150650
11 Ga0160469_100896 3300012824 Bacteria 10141
12 Ga0466690_159485 3300042590 Bacteria 2178
13 Ga0466690_221425 3300042590 Bacteria 8535
14 IMNBL1DRAFT_c0000849 3300000062 Bacteria 23988
15 JGI24696J40584_12956605 3300002834 Bacteria 3167
16 Ga0072940_1052442 3300005200 Bacteria 1633
17 Ga0104045_1020669 3300007085 Bacteria 1582
18 Ga0466709_007878 3300042648 Bacteria 27583
19 Ga0466708_431054 3300042652 Bacteria 13726
20 Ga0466701_058922 3300042598 Bacteria 11436
21 Ga0466701_101439 3300042598 Bacteria 2465
22 Ga0466706_089391 3300042599 Bacteria 6268
23 Ga0466713_025514 3300042602 Bacteria 114544
24 Ga0466710_067550 3300042613 Bacteria 1596
25 Ga0466723_024955 3300042618 Bacteria 6081
26 Ga0466723_198328 3300042618 Bacteria 15765
27 Ga0466726_381661 3300042619 Bacteria 3925
28 Ga0160458_100163 3300012832 Bacteria 54647
29 Ga0160433_100237 3300012846 Bacteria 40097
30 Ga0466690_014837 3300042590 Bacteria 8618
31 Ga0466691_023235 3300042593 Bacteria 11215
32 Ga0466696_089643 3300042596 Bacteria 20002
33 Ga0466696_176785 3300042596 Bacteria 19925
34 Ga0123357_10298910 3300009784 Bacteria 1630
35 Ga0123356_10081964 3300010049 Bacteria 3053
36 Ga0123353_10001838 3300010167 Bacteria 26117
37 2227477401 2225789004 Bacteria 22517
38 JGI24696J40584_12961710 3300002834 Bacteria 45969
39 Ga0466735_021202 3300042624 Bacteria 8101
40 Ga0466701_102144 3300042598 Bacteria 141929
41 Ga0466698_404598 3300042610 Bacteria 7756
42 Ga0466697_182070 3300042611 Bacteria 8207
43 Ga0466733_146496 3300042659 Bacteria 8541
44 Ga0466711_095847 3300042615 Bacteria 3886
45 Ga0466711_126844 3300042615 Bacteria 12736
46 Ga0466711_306552 3300042615 Bacteria 3587
47 Ga0466715_030580 3300042616 Bacteria 6573
48 Ga0160441_100214 3300012825 Bacteria 58247
49 Ga0160445_100225 3300012847 Bacteria 41313
50 Ga0160445_100247 3300012847 Bacteria 38666
51 Ga0160443_100077 3300012848 Bacteria 175780
52 Ga0160435_1000335 3300012857 Bacteria 19209
53 Ga0466657_053247 3300042582 Bacteria 11760
54 Ga0123353_10000970 3300010167 Bacteria 35107
55 Ga0123353_10012477 3300010167 Bacteria 12084
56 Ga0123353_10026371 3300010167 Bacteria 8875
57 Ga0104045_1002981 3300007085 Bacteria 11834
58 Ga0466729_296814 3300042621 Bacteria 9330
59 Ga0466727_288541 3300042655 Bacteria 3685
60 Ga0466706_127960 3300042599 Bacteria 71121
61 Ga0466707_276777 3300042601 Bacteria 7753
62 Ga0466707_405313 3300042601 Bacteria 13801
63 Ga0466714_036086 3300042603 Bacteria 3262
64 Ga0466714_094553 3300042603 Bacteria 52205
65 Ga0466719_302903 3300042606 Bacteria 1959
66 Ga0466711_264063 3300042615 Bacteria 1724
67 Ga0466715_186486 3300042616 Bacteria 9969
68 Ga0466723_104379 3300042618 Bacteria 2940
69 Ga0466726_113249 3300042619 Bacteria 4996
70 Ga0466729_186551 3300042621 Bacteria 3344
71 Ga0160430_101679 3300012852 Bacteria 7869
72 Ga0466690_233574 3300042590 Bacteria 4210
73 Ga0123356_10005344 3300010049 Bacteria 13093
74 Ga0123353_10009932 3300010167 Bacteria 13205
75 Ga0123354_10155753 3300010882 Bacteria 2742
76 Ga0123354_10174882 3300010882 Bacteria 2480
77 IMNBL1DRAFT_c0003597 3300000062 Bacteria 9826
78 JGI24702J35022_10001574 3300002462 Bacteria 14155
79 Ga0104050_1203029 3300007153 Bacteria 1529
80 Ga0466703_280154 3300042636 Bacteria 19691
81 Ga0466709_124130 3300042648 Bacteria 272718
82 Ga0466724_68743 3300042649 Bacteria 337166
83 Ga0466701_042033 3300042598 Bacteria 8191
84 Ga0466706_003908 3300042599 Bacteria 8357
85 Ga0466706_080160 3300042599 Bacteria 27176
86 Ga0466713_006786 3300042602 Bacteria 13628
87 Ga0466714_030110 3300042603 Bacteria 34101
88 Ga0466733_089518 3300042659 Bacteria 53582
89 Ga0466711_058433 3300042615 Bacteria 7793
90 Ga0466718_044003 3300042617 Bacteria 25874
91 Ga0160432_100020 3300012818 Bacteria 281080
92 Ga0160467_100260 3300012829 Bacteria 64032
93 Ga0160467_103006 3300012829 Bacteria 3141
94 Ga0160443_100149 3300012848 Bacteria 101080
95 Ga0466694_076728 3300042594 Bacteria 24457
96 Ga0466701_006324 3300042598 Unclassified 7709
97 Ga0123354_10230782 3300010882 Bacteria 1935
98 2227164440 2225789004 Bacteria 1544
99 IMNBL1DRAFT_c0013246 3300000062 Bacteria 3713
100 Ga0068305_10343316 3300005083 Bacteria 1575
101 Ga0104048_1001901 3300007143 Bacteria 3176
102 Ga0466731_008971 3300042622 Bacteria 33045
103 Ga0466735_158279 3300042624 Bacteria 9325
104 Ga0466709_130773 3300042648 Bacteria 58613
105 Ga0466709_147679 3300042648 Bacteria 7283
106 Ga0466724_34893 3300042649 Bacteria 121190
107 Ga0466716_151473 3300042605 Bacteria 8091
108 Ga0466719_105264 3300042606 Bacteria 12979
109 Ga0466719_319393 3300042606 Bacteria 2254
110 Ga0466722_124719 3300042609 Bacteria 18358
111 Ga0466733_096786 3300042659 Bacteria 3876
112 Ga0466710_287011 3300042613 Bacteria 2315
113 Ga0160433_100443 3300012846 Bacteria 21342
114 Ga0466691_009431 3300042593 Bacteria 6007
115 Ga0466701_007914 3300042598 Bacteria 29857
116 Ga0466701_015235 3300042598 Bacteria 2633
117 Ga0123353_10000041 3300010167 Bacteria 137212
118 JGI24698J34947_10073961 3300002449 Bacteria 1624
119 JGI24696J40584_12958679 3300002834 Bacteria 4322
120 Ga0068302_10003974 3300005071 Bacteria 4140
121 Ga0466730_073669 3300042625 Bacteria 406091
122 Ga0466708_036877 3300042652 Bacteria 3527
123 Ga0466713_034599 3300042602 Bacteria 147320
124 Ga0466714_015825 3300042603 Bacteria 102725
125 Ga0466719_559050 3300042606 Bacteria 1817
126 Ga0466712_024442 3300042614 Unclassified 2482
127 Ga0466712_099766 3300042614 Unclassified 1715
128 Ga0466715_567168 3300042616 Bacteria 3615
129 Ga0160446_100004 3300012835 Bacteria 459440
130 Ga0123353_10019033 3300010167 Bacteria 10187
131 2227663506 2225789004 Bacteria 10430
132 Ga0104048_1004042 3300007143 Bacteria 18967
133 Ga0104050_1199698 3300007153 Unclassified 4653
134 Ga0466735_171261 3300042624 Bacteria 7366
135 Ga0466703_004201 3300042636 Bacteria 12342
136 Ga0466709_190184 3300042648 Bacteria 38440
137 Ga0466727_148046 3300042655 Bacteria 1956
138 Ga0466701_100931 3300042598 Bacteria 4490
139 Ga0466706_025174 3300042599 Bacteria 118676
140 Ga0466713_063293 3300042602 Bacteria 52242
141 Ga0466713_083609 3300042602 Bacteria 30631
142 Ga0466733_074709 3300042659 Bacteria 47803
143 Ga0562377_0004 3300056842 Bacteria 3525959
144 Ga0160453_100381 3300012814 Bacteria 37283
145 Ga0160472_100031 3300012839 Bacteria 275018
146 Ga0466696_100700 3300042596 Bacteria 6158
147 Ga0123356_10004059 3300010049 Bacteria 15203
148 Ga0123353_10000005 3300010167 Bacteria 308504
149 Ga0123353_10040915 3300010167 Bacteria 7316
150 Ga0123353_10376284 3300010167 Bacteria 2126
151 Ga0123353_10394731 3300010167 Bacteria 2062
152 Ga0123354_10078842 3300010882 Bacteria 4678
153 Ga0123354_10186502 3300010882 Unclassified 2343
154 Ga0123354_10228994 3300010882 Bacteria 1949
155 Ga0160464_101684 3300012805 Bacteria 6325
156 IMNBL1DRAFT_c0021006 3300000062 Bacteria 2625
157 JGI24695J34938_10002688 3300002450 Bacteria 13235
158 Ga0466731_293300 3300042622 Bacteria 2241
159 Ga0466703_024275 3300042636 Bacteria 27229
160 Ga0466724_41297 3300042649 Bacteria 4417
161 Ga0466724_46039 3300042649 Bacteria 4433
162 Ga0466707_272049 3300042601 Bacteria 5307
163 Ga0466716_226283 3300042605 Bacteria 9940
164 Ga0466719_149199 3300042606 Bacteria 1866
165 Ga0466720_230677 3300042607 Bacteria 3732

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042622 Ga0466731_293300 Ga0466731_293300_474_1610 378
2 3300000062 IMNBL1DRAFT_c0000849 IMNBL1DRAFT_00008498 390
3 3300042648 Ga0466709_147679 Ga0466709_147679_457_1692 393
4 3300012835 Ga0160446_100004 Ga0160446_10000471 394
5 3300042603 Ga0466714_094553 Ga0466714_094553_28014_29264 394
6 2225789004 2227477401 2227931326 403
7 3300012848 Ga0160443_100149 Ga0160443_10014927 407
8 3300042602 Ga0466713_006786 Ga0466713_006786_12218_13441 407
9 3300042602 Ga0466713_025514 Ga0466713_025514_92064_93287 407
10 3300042602 Ga0466713_083609 Ga0466713_083609_23587_24810 407
11 3300042612 Ga0466705_289260 Ga0466705_289260_1362_2585 407
12 3300042636 Ga0466703_280154 Ga0466703_280154_5693_6916 407
13 3300042648 Ga0466709_130773 Ga0466709_130773_44575_45798 407
14 3300042659 Ga0466733_174420 Ga0466733_174420_4032_5255 407
15 iso_pr_bacteria 2695420314 2695474124 407
16 iso_pr_bacteria 2910959314 2910961391 407
17 iso_pr_bacteria 8100166142 8100168068 407
18 3300005083 Ga0068305_10343316 Ga0068305_103433161 408
19 3300042601 Ga0466707_405313 Ga0466707_405313_6682_7908 408
20 3300042615 Ga0466711_126844 Ga0466711_126844_1337_2563 408
21 3300042659 Ga0466733_089518 Ga0466733_089518_15183_16409 408
22 3300042659 Ga0466733_157382 Ga0466733_157382_302_1528 408
23 3300056842 Ga0562377_0004 Ga0562377_0004_1288463_1289689 408
24 iso_pr_bacteria 2695420317 2695483917 408
25 iso_pr_bacteria 2695420931 2698110410 408
26 iso_pr_bacteria 2873600114 2873603445 408
27 iso_pr_bacteria 2873610414 2873613836 408
28 iso_pr_bacteria 2910926975 2910927795 408
29 iso_pr_bacteria 2940244548 2940247133 408
30 iso_pr_bacteria 2940248789 2940250849 408
31 iso_pr_bacteria 2940253009 2940255245 408
32 iso_pr_bacteria 2940257232 2940259242 408
33 iso_pr_bacteria 8100157865 8100161720 408
34 3300042602 Ga0466713_034599 Ga0466713_034599_88506_89735 409
35 iso_pr_bacteria 2910942425 2910944828 409
36 3300042603 Ga0466714_030110 Ga0466714_030110_19689_20921 410
37 3300042605 Ga0466716_151473 Ga0466716_151473_5926_7158 410
38 2225789004 2227164440 2227576286 411
39 2225789004 2227663506 2228265281 411
40 3300042590 Ga0466690_014837 Ga0466690_014837_5224_6459 411
41 3300042590 Ga0466690_221425 Ga0466690_221425_315_1550 411
42 3300042593 Ga0466691_009431 Ga0466691_009431_1325_2560 411
43 3300042596 Ga0466696_089643 Ga0466696_089643_17498_18733 411
44 3300042601 Ga0466707_272049 Ga0466707_272049_1941_3176 411
45 3300042606 Ga0466719_105264 Ga0466719_105264_2876_4111 411
46 3300042606 Ga0466719_302903 Ga0466719_302903_266_1501 411
47 3300042606 Ga0466719_319393 Ga0466719_319393_971_2206 411
48 3300042615 Ga0466711_306552 Ga0466711_306552_1878_3113 411
49 3300042616 Ga0466715_186486 Ga0466715_186486_3921_5156 411
50 3300042618 Ga0466723_104379 Ga0466723_104379_978_2213 411
51 3300042652 Ga0466708_036877 Ga0466708_036877_1617_2852 411
52 3300042652 Ga0466708_431054 Ga0466708_431054_7619_8854 411
53 iso_pr_bacteria 2910930387 2910931071 411
54 3300010167 Ga0123353_10019033 Ga0123353_100190335 412
55 3300010882 Ga0123354_10078842 Ga0123354_100788422 412
56 3300010882 Ga0123354_10186502 Ga0123354_101865022 412
57 3300042603 Ga0466714_036086 Ga0466714_036086_229_1467 412
58 3300042606 Ga0466719_149199 Ga0466719_149199_26_1264 412
59 3300042609 Ga0466722_124719 Ga0466722_124719_6065_7303 412
60 3300042614 Ga0466712_024442 Ga0466712_024442_236_1474 412
61 3300042614 Ga0466712_099766 Ga0466712_099766_128_1366 412
62 3300042615 Ga0466711_058433 Ga0466711_058433_1937_3175 412
63 3300042617 Ga0466718_044003 Ga0466718_044003_3993_5231 412
64 3300042618 Ga0466723_013453 Ga0466723_013453_3332_4570 412
65 3300042618 Ga0466723_024955 Ga0466723_024955_155_1393 412
66 3300042648 Ga0466709_124130 Ga0466709_124130_37394_38632 412
67 3300042655 Ga0466727_148046 Ga0466727_148046_434_1672 412
68 3300042659 Ga0466733_146496 Ga0466733_146496_6221_7459 412
69 3300002449 JGI24698J34947_10073961 JGI24698J34947_100739612 413
70 3300002834 JGI24696J40584_12958679 JGI24696J40584_129586794 413
71 3300010167 Ga0123353_10376284 Ga0123353_103762842 413
72 3300010167 Ga0123353_10394731 Ga0123353_103947312 413
73 3300010882 Ga0123354_10228994 Ga0123354_102289942 413
74 3300012852 Ga0160430_101679 Ga0160430_1016796 413
75 3300042582 Ga0466657_053247 Ga0466657_053247_2604_3845 413
76 3300042598 Ga0466701_007914 Ga0466701_007914_22552_23793 413
77 3300042598 Ga0466701_015235 Ga0466701_015235_1051_2292 413
78 3300042605 Ga0466716_226283 Ga0466716_226283_5436_6677 413
79 3300042612 Ga0466705_310929 Ga0466705_310929_4198_5439 413
80 3300042618 Ga0466723_198328 Ga0466723_198328_14030_15271 413
81 3300042619 Ga0466726_113249 Ga0466726_113249_1040_2281 413
82 3300042624 Ga0466735_021202 Ga0466735_021202_663_1904 413
83 3300042624 Ga0466735_171261 Ga0466735_171261_3041_4282 413
84 3300042636 Ga0466703_004201 Ga0466703_004201_4962_6203 413
85 3300042648 Ga0466709_190184 Ga0466709_190184_14477_15718 413
86 3300042649 Ga0466724_68743 Ga0466724_68743_6302_7543 413
87 iso_pr_bacteria 2820783511 2820784600 413
88 3300002462 JGI24702J35022_10001574 JGI24702J35022_100015749 414
89 3300010049 Ga0123356_10004059 Ga0123356_1000405912 414
90 3300010167 Ga0123353_10000041 Ga0123353_1000004196 414
91 3300010882 Ga0123354_10230782 Ga0123354_102307823 414
92 3300012825 Ga0160441_100214 Ga0160441_10021412 414
93 3300012839 Ga0160472_100031 Ga0160472_100031173 414
94 3300042590 Ga0466690_233574 Ga0466690_233574_1227_2471 414
95 3300042598 Ga0466701_006324 Ga0466701_006324_6193_7437 414
96 3300042598 Ga0466701_042033 Ga0466701_042033_6675_7919 414
97 3300042598 Ga0466701_102144 Ga0466701_102144_61686_62930 414
98 3300042602 Ga0466713_063293 Ga0466713_063293_38890_40134 414
99 3300042613 Ga0466710_287011 Ga0466710_287011_962_2206 414
100 3300042615 Ga0466711_095847 Ga0466711_095847_2193_3437 414
101 3300042619 Ga0466726_381661 Ga0466726_381661_1590_2834 414
102 3300042620 Ga0466728_327686 Ga0466728_327686_13591_14835 414
103 3300042621 Ga0466729_186551 Ga0466729_186551_479_1723 414
104 iso_pr_bacteria 2838772460 2838774185 414
105 iso_pr_bacteria 2873776654 2873781709 414
106 iso_pr_bacteria 2899132286 2899134149 414
107 3300007143 Ga0104048_1001901 Ga0104048_10019014 415
108 3300007143 Ga0104048_1004042 Ga0104048_100404221 415
109 3300007153 Ga0104050_1203029 Ga0104050_12030292 415
110 3300042596 Ga0466696_176785 Ga0466696_176785_1866_3113 415
111 3300042599 Ga0466706_080160 Ga0466706_080160_22502_23749 415
112 3300042607 Ga0466720_230677 Ga0466720_230677_907_2154 415
113 3300042613 Ga0466710_067550 Ga0466710_067550_214_1461 415
114 3300042648 Ga0466709_007878 Ga0466709_007878_24756_26003 415
115 3300042649 Ga0466724_34893 Ga0466724_34893_10797_12044 415
116 iso_pr_bacteria 2882250448 2882251518 415
117 iso_pr_bacteria 2894649344 2894650929 415
118 3300005200 Ga0072940_1052442 Ga0072940_10524422 416
119 3300009784 Ga0123357_10298910 Ga0123357_102989101 416
120 3300012805 Ga0160464_101684 Ga0160464_1016842 416
121 3300012814 Ga0160453_100381 Ga0160453_10038122 416
122 3300012846 Ga0160433_100237 Ga0160433_10023725 416
123 3300012847 Ga0160445_100247 Ga0160445_10024715 416
124 3300042599 Ga0466706_003908 Ga0466706_003908_1212_2462 416
125 3300042611 Ga0466697_182070 Ga0466697_182070_5590_6840 416
126 3300042624 Ga0466735_158279 Ga0466735_158279_544_1794 416
127 3300042659 Ga0466733_074709 Ga0466733_074709_43162_44412 416
128 iso_pr_bacteria 2590828803 2592927754 416
129 iso_pr_bacteria 2820797595 2820798154 416
130 3300002834 JGI24696J40584_12961710 JGI24696J40584_1296171025 417
131 3300010049 Ga0123356_10005344 Ga0123356_100053443 417
132 3300010049 Ga0123356_10081964 Ga0123356_100819643 417
133 3300010167 Ga0123353_10000970 Ga0123353_100009703 417
134 3300010882 Ga0123354_10174882 Ga0123354_101748822 417
135 3300012819 Ga0160468_100062 Ga0160468_100062120 417
136 3300042599 Ga0466706_127960 Ga0466706_127960_43438_44691 417
137 3300042606 Ga0466719_559050 Ga0466719_559050_271_1524 417
138 3300042615 Ga0466711_264063 Ga0466711_264063_142_1395 417
139 3300042619 Ga0466726_049641 Ga0466726_049641_2812_4065 417
140 3300042622 Ga0466731_008971 Ga0466731_008971_26029_27282 417
141 3300042649 Ga0466724_41297 Ga0466724_41297_3012_4265 417
142 iso_pr_bacteria 2811995047 2812946420 417
143 iso_pr_bacteria 2864878056 2864879542 417
144 iso_pr_bacteria 2864886855 2864888343 417
145 iso_pr_bacteria 2920168565 2920169814 417
146 3300007085 Ga0104045_1002981 Ga0104045_10029818 418
147 3300007153 Ga0104050_1199698 Ga0104050_11996983 418
148 3300012829 Ga0160467_103006 Ga0160467_1030062 418
149 3300012847 Ga0160445_100225 Ga0160445_10022530 418
150 3300012848 Ga0160443_100077 Ga0160443_10007785 418
151 3300012857 Ga0160435_1000335 Ga0160435_100033510 418
152 3300042590 Ga0466690_159485 Ga0466690_159485_174_1430 418
153 3300042599 Ga0466706_089391 Ga0466706_089391_1888_3144 418
154 3300042616 Ga0466715_567168 Ga0466715_567168_1127_2383 418
155 3300042619 Ga0466726_474730 Ga0466726_474730_1217_2473 418
156 3300042655 Ga0466727_288541 Ga0466727_288541_50_1306 418
157 3300010167 Ga0123353_10001838 Ga0123353_1000183810 419
158 3300010167 Ga0123353_10012477 Ga0123353_100124776 419
159 3300042598 Ga0466701_100931 Ga0466701_100931_195_1454 419
160 3300042598 Ga0466701_101439 Ga0466701_101439_195_1454 419
161 3300042616 Ga0466715_301846 Ga0466715_301846_1748_3007 419
162 3300042621 Ga0466729_296814 Ga0466729_296814_3975_5234 419
163 3300042625 Ga0466730_073669 Ga0466730_073669_115941_117200 419
164 3300042649 Ga0466724_46039 Ga0466724_46039_3022_4281 419
165 3300007085 Ga0104045_1020669 Ga0104045_10206691 420
166 3300012824 Ga0160469_100896 Ga0160469_1008964 420
167 3300012832 Ga0160458_100163 Ga0160458_10016323 420
168 3300012846 Ga0160433_100443 Ga0160433_1004434 420
169 3300042593 Ga0466691_023235 Ga0466691_023235_4097_5359 420
170 3300042636 Ga0466703_024275 Ga0466703_024275_14308_15570 420
171 3300002834 JGI24696J40584_12956605 JGI24696J40584_129566053 421
172 3300010882 Ga0123354_10155753 Ga0123354_101557533 421
173 3300012818 Ga0160432_100020 Ga0160432_10002042 421
174 3300012829 Ga0160467_100260 Ga0160467_10026016 421
175 iso_pr_bacteria 2820753519 2820754900 421
176 iso_pr_bacteria 2820755292 2820756563 421
177 3300010167 Ga0123353_10040915 Ga0123353_100409156 422
178 3300042596 Ga0466696_100700 Ga0466696_100700_398_1666 422
179 3300042598 Ga0466701_058922 Ga0466701_058922_2508_3776 422
180 3300005071 Ga0068302_10003974 Ga0068302_100039741 423
181 3300042594 Ga0466694_076728 Ga0466694_076728_9712_10983 423
182 iso_pr_bacteria 2509276035 2509458734 423
183 iso_pr_bacteria 2820768849 2820769413 423
184 iso_pr_bacteria 2820774381 2820774601 423
185 3300010167 Ga0123353_10000005 Ga0123353_10000005253 424
186 iso_pr_bacteria 2820792843 2820794324 424
187 iso_pr_bacteria 2820795054 2820796027 424
188 3300000062 IMNBL1DRAFT_c0021006 IMNBL1DRAFT_00210062 425
189 3300000062 IMNBL1DRAFT_c0003597 IMNBL1DRAFT_00035975 427
190 3300042616 Ga0466715_030580 Ga0466715_030580_4386_5672 428
191 3300042601 Ga0466707_276777 Ga0466707_276777_6346_7641 431
192 3300042603 Ga0466714_015825 Ga0466714_015825_60868_62172 434
193 3300042610 Ga0466698_404598 Ga0466698_404598_4045_5349 434
194 3300042659 Ga0466733_096786 Ga0466733_096786_1319_2623 434
195 3300002450 JGI24695J34938_10002688 JGI24695J34938_1000268811 435
196 3300000062 IMNBL1DRAFT_c0013246 IMNBL1DRAFT_00132462 439
197 3300010167 Ga0123353_10026371 Ga0123353_100263715 440
198 3300010167 Ga0123353_10009932 Ga0123353_100099327 453
199 3300042599 Ga0466706_025174 Ga0466706_025174_40080_41513 460

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02464 CinA Competence-damaged protein 310 457 0.95
PF00994 MoCF_biosynth Probable molybdopterin binding domain 69 234 0.94
PF18146 CinA_KH Damage-inducible protein CinA KH domain 245 316 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.55 0.61 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.