Protein Family IF05551
Metagenome
Metatranscriptome
Isolate
146
Members
77
Samples
109
Scaffolds
287.69
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_004269|Ga0466706_004269_122_1000
- Length
- 292 aa
- Sequence
- MKLTEVLKNTRKEKYAVGSFSPRYLRSIEPVLRAAQKAKSPLIVQISQGELERFFATPKEFYDRFSRVKSELGITVPVTLHLDHTKDLAIISAAVDAGFESVMIDASQYPLEENIAITKKAIAIAHPRGVQVEGELGKITSMDKIETDSDSELYTDPEEVRIFVRETGVDVLAISVGTVHGAYLTIKPYIDVKRIGEIRQVTDLPLVLHGASGVPAEMVKSAYQMDCGGVSKINIATDLEAAFLKAIGEPTSLTNISVENVSAELLKKGAEAVEATVTDKIYNFLQSDGKAW
Sample Types
Isolate
25.3%
Metagenome
73.3%
MAG
0.0%
Metatranscriptome
1.4%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
34.2%
Termitidae
23.7%
Blattidae
15.8%
Rhinotermitidae
3.9%
Formicidae
3.9%
Termopsidae
3.9%
Kalotermitidae
2.6%
Passalidae
2.6%
Hodotermitidae
1.3%
Drosophilidae
1.3%
Acrididae
1.3%
Hydrophilidae
1.3%
Plutellidae
1.3%
Noctuidae
1.3%
Scarabaeidae
1.3%
Taxonomy
Archaea
0
Bacteria
139
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 2 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 3 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 4 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 5 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 6 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 17 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 18 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 19 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300005313 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 2 gut | Metagenome | Drosophilidae |
| 25 | 3300007901 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii | Metagenome | Formicidae |
| 26 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 27 | 2820592308 | Unclassified Firmicutes Emb289P1bin71 | Isolate | Unclassified |
| 28 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 35 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 36 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 37 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 38 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 39 | 2035265001 | Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 | Metagenome | Acrididae |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 44 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 45 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 46 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 47 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 48 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 49 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 50 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 51 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 52 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 53 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 54 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 55 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 56 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 57 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 58 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 59 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 60 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 61 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 62 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 63 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 64 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 65 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 66 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 67 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 68 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 69 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 70 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 71 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 72 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 73 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 74 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 75 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 76 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 77 | 3300026558 | Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | 2227236341 | 2225789004 | Bacteria | 7301 |
| 2 | IMNBL1DRAFT_c0003403 | 3300000062 | Bacteria | 10261 |
| 3 | Ga0466706_117117 | 3300042599 | Bacteria | 2266 |
| 4 | Ga0466706_236059 | 3300042599 | Bacteria | 9194 |
| 5 | Ga0466722_023977 | 3300042609 | Bacteria | 9810 |
| 6 | Ga0466722_037673 | 3300042609 | Bacteria | 1667 |
| 7 | Ga0255809_1067514 | 3300022820 | Bacteria | 953 |
| 8 | Ga0255576_1000003 | 3300026558 | Bacteria | 267799 |
| 9 | Ga0466692_194805 | 3300042591 | Bacteria | 3477 |
| 10 | Ga0466693_158579 | 3300042592 | Bacteria | 4528 |
| 11 | Ga0123355_10175927 | 3300009826 | Bacteria | 3187 |
| 12 | Ga0123355_10257869 | 3300009826 | Bacteria | 2443 |
| 13 | Ga0123356_10506138 | 3300010049 | Bacteria | 1364 |
| 14 | Ga0123354_10288169 | 3300010882 | Unclassified | 1579 |
| 15 | Ga0466727_043933 | 3300042655 | Bacteria | 2282 |
| 16 | GhopperDRAF_NODE_285309_len_3934_cov_6_886630 | 2035265001 | Bacteria | 3964 |
| 17 | JGI24705J35276_12195640 | 3300002504 | Bacteria | 1528 |
| 18 | Ga0111035_101356 | 3300007901 | Bacteria | 30372 |
| 19 | Ga0466715_061408 | 3300042616 | Bacteria | 135358 |
| 20 | Ga0466706_004269 | 3300042599 | Bacteria | 2309 |
| 21 | Ga0466706_116573 | 3300042599 | Bacteria | 37507 |
| 22 | Ga0466706_130274 | 3300042599 | Bacteria | 48675 |
| 23 | Ga0466706_154904 | 3300042599 | Bacteria | 77574 |
| 24 | Ga0466706_174063 | 3300042599 | Bacteria | 7804 |
| 25 | Ga0466706_198543 | 3300042599 | Bacteria | 17171 |
| 26 | Ga0466706_238501 | 3300042599 | Unclassified | 1199 |
| 27 | Ga0466706_248624 | 3300042599 | Bacteria | 3494 |
| 28 | Ga0466700_138146 | 3300042600 | Bacteria | 1071 |
| 29 | Ga0123355_10257253 | 3300009826 | Bacteria | 2448 |
| 30 | Ga0123355_10452877 | 3300009826 | Bacteria | 1616 |
| 31 | Ga0466703_226987 | 3300042636 | Bacteria | 8966 |
| 32 | Ga0466724_52280 | 3300042649 | Bacteria | 15665 |
| 33 | IMNBL1DRAFT_c0000688 | 3300000062 | Bacteria | 27084 |
| 34 | Ga0072941_1090574 | 3300005201 | Bacteria | 8845 |
| 35 | Ga0466706_072593 | 3300042599 | Bacteria | 8308 |
| 36 | Ga0466706_215257 | 3300042599 | Unclassified | 6058 |
| 37 | Ga0466706_246148 | 3300042599 | Bacteria | 77658 |
| 38 | Ga0466706_274157 | 3300042599 | Bacteria | 2889 |
| 39 | Ga0123355_10006818 | 3300009826 | Bacteria | 16993 |
| 40 | Ga0123355_10188125 | 3300009826 | Bacteria | 3048 |
| 41 | Ga0123355_10343279 | 3300009826 | Bacteria | 1987 |
| 42 | Ga0466725_268002 | 3300042654 | Bacteria | 8987 |
| 43 | Ga0466733_169086 | 3300042659 | Bacteria | 1189 |
| 44 | Ga0466733_181671 | 3300042659 | Bacteria | 1529 |
| 45 | 2227469074 | 2225789004 | Unclassified | 24064 |
| 46 | Ga0052191_103178 | 3300003097 | Bacteria | 3185 |
| 47 | Ga0466718_011451 | 3300042617 | Bacteria | 1558 |
| 48 | Ga0466729_153988 | 3300042621 | Bacteria | 1678 |
| 49 | Ga0466706_068655 | 3300042599 | Bacteria | 17309 |
| 50 | Ga0466706_078368 | 3300042599 | Bacteria | 15201 |
| 51 | Ga0466706_105823 | 3300042599 | Bacteria | 25108 |
| 52 | Ga0466722_142744 | 3300042609 | Bacteria | 2084 |
| 53 | Ga0123355_10001408 | 3300009826 | Bacteria | 33548 |
| 54 | Ga0123355_10053633 | 3300009826 | Bacteria | 6536 |
| 55 | Ga0123355_10320308 | 3300009826 | Bacteria | 2090 |
| 56 | Ga0123355_10417966 | 3300009826 | Bacteria | 1716 |
| 57 | Ga0123355_10422325 | 3300009826 | Bacteria | 1703 |
| 58 | Ga0123353_10721117 | 3300010167 | Bacteria | 1395 |
| 59 | Ga0123354_10047859 | 3300010882 | Bacteria | 6510 |
| 60 | Ga0466735_122448 | 3300042624 | Bacteria | 25397 |
| 61 | IMNBL1DRAFT_c0021955 | 3300000062 | Bacteria | 2538 |
| 62 | Ga0466706_070845 | 3300042599 | Unclassified | 12423 |
| 63 | Ga0466706_134420 | 3300042599 | Bacteria | 46018 |
| 64 | Ga0466714_144110 | 3300042603 | Bacteria | 18559 |
| 65 | Ga0123355_10335859 | 3300009826 | Bacteria | 2018 |
| 66 | Ga0123355_10387834 | 3300009826 | Bacteria | 1813 |
| 67 | Ga0123353_10151652 | 3300010167 | Bacteria | 3699 |
| 68 | Ga0466735_040955 | 3300042624 | Bacteria | 4648 |
| 69 | Ga0466735_233438 | 3300042624 | Bacteria | 96886 |
| 70 | Ga0466725_325126 | 3300042654 | Bacteria | 18511 |
| 71 | Ga0466733_109390 | 3300042659 | Bacteria | 1936 |
| 72 | IMNBL1DRAFT_c0000174 | 3300000062 | Bacteria | 57893 |
| 73 | Ga0102734_1000006 | 3300007129 | Bacteria | 72725 |
| 74 | Ga0466729_017964 | 3300042621 | Bacteria | 95785 |
| 75 | Ga0466706_130551 | 3300042599 | Bacteria | 17368 |
| 76 | Ga0466706_132036 | 3300042599 | Unclassified | 3565 |
| 77 | Ga0466721_251509 | 3300042608 | Bacteria | 170691 |
| 78 | Ga0247289_2750 | 3300035363 | Bacteria | 1083 |
| 79 | Ga0123355_10917245 | 3300009826 | Bacteria | 948 |
| 80 | Ga0123353_10472719 | 3300010167 | Bacteria | 1837 |
| 81 | Ga0466725_460104 | 3300042654 | Bacteria | 3996 |
| 82 | IMNBL1DRAFT_c0009138 | 3300000062 | Bacteria | 4944 |
| 83 | JGI24695J34938_10000824 | 3300002450 | Bacteria | 28821 |
| 84 | Ga0068305_10126424 | 3300005083 | Bacteria | 9997 |
| 85 | Ga0466715_032155 | 3300042616 | Bacteria | 207155 |
| 86 | Ga0466706_045168 | 3300042599 | Bacteria | 13971 |
| 87 | Ga0466706_100653 | 3300042599 | Bacteria | 11682 |
| 88 | Ga0466714_032177 | 3300042603 | Bacteria | 1394 |
| 89 | Ga0466717_158033 | 3300042604 | Bacteria | 2715 |
| 90 | Ga0123353_10467761 | 3300010167 | Bacteria | 1850 |
| 91 | Ga0123353_10640531 | 3300010167 | Bacteria | 1507 |
| 92 | Ga0466733_138139 | 3300042659 | Bacteria | 28844 |
| 93 | 2227219676 | 2225789004 | Unclassified | 33633 |
| 94 | 2227544081 | 2225789004 | Bacteria | 15391 |
| 95 | IMNBL1DRAFT_c0004887 | 3300000062 | Bacteria | 7871 |
| 96 | Ga0072941_1004700 | 3300005201 | Bacteria | 115922 |
| 97 | Ga0074307_1108422 | 3300005313 | Bacteria | 1815 |
| 98 | Ga0466726_460941 | 3300042619 | Bacteria | 22533 |
| 99 | Ga0466706_097710 | 3300042599 | Bacteria | 15526 |
| 100 | Ga0466707_005492 | 3300042601 | Bacteria | 129837 |
| 101 | Ga0466713_089196 | 3300042602 | Bacteria | 75262 |
| 102 | Ga0466714_004535 | 3300042603 | Bacteria | 32886 |
| 103 | Ga0466714_006173 | 3300042603 | Bacteria | 1157 |
| 104 | Ga0466714_139125 | 3300042603 | Bacteria | 4891 |
| 105 | Ga0222431_1007454 | 3300021190 | Bacteria | 1206 |
| 106 | Ga0466699_292908 | 3300042597 | Bacteria | 3888 |
| 107 | Ga0123355_10035635 | 3300009826 | Bacteria | 8087 |
| 108 | Ga0123355_10172454 | 3300009826 | Bacteria | 3229 |
| 109 | Ga0123356_10811411 | 3300010049 | Bacteria | 1107 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300021190 | Ga0222431_1007454 | Ga0222431_10074542 | 257 |
| 2 | 3300022820 | Ga0255809_1067514 | Ga0255809_10675142 | 268 |
| 3 | 3300042600 | Ga0466700_138146 | Ga0466700_138146_36_899 | 273 |
| 4 | 3300042621 | Ga0466729_153988 | Ga0466729_153988_586_1449 | 279 |
| 5 | 3300042599 | Ga0466706_248624 | Ga0466706_248624_171_1013 | 280 |
| 6 | iso_pr_bacteria | 2820592308 | 2820592623 | 280 |
| 7 | 3300010049 | Ga0123356_10811411 | Ga0123356_108114111 | 281 |
| 8 | 3300042592 | Ga0466693_158579 | Ga0466693_158579_1526_2374 | 282 |
| 9 | 3300042659 | Ga0466733_109390 | Ga0466733_109390_155_1009 | 284 |
| 10 | 2225789004 | 2227469074 | 2227912187 | 287 |
| 11 | 2225789004 | 2227544081 | 2228068231 | 287 |
| 12 | 3300042597 | Ga0466699_292908 | Ga0466699_292908_2441_3304 | 287 |
| 13 | 3300042599 | Ga0466706_045168 | Ga0466706_045168_2667_3530 | 287 |
| 14 | 3300042599 | Ga0466706_068655 | Ga0466706_068655_10648_11511 | 287 |
| 15 | 3300042599 | Ga0466706_072593 | Ga0466706_072593_7210_8073 | 287 |
| 16 | 3300042599 | Ga0466706_100653 | Ga0466706_100653_6819_7682 | 287 |
| 17 | 3300042599 | Ga0466706_174063 | Ga0466706_174063_2852_3715 | 287 |
| 18 | 3300042599 | Ga0466706_198543 | Ga0466706_198543_10617_11480 | 287 |
| 19 | 3300042599 | Ga0466706_236059 | Ga0466706_236059_6496_7359 | 287 |
| 20 | 3300042601 | Ga0466707_005492 | Ga0466707_005492_42126_42989 | 287 |
| 21 | 3300042602 | Ga0466713_089196 | Ga0466713_089196_25146_26009 | 287 |
| 22 | 3300042603 | Ga0466714_004535 | Ga0466714_004535_9233_10096 | 287 |
| 23 | 3300042603 | Ga0466714_006173 | Ga0466714_006173_202_1065 | 287 |
| 24 | 3300042603 | Ga0466714_144110 | Ga0466714_144110_14891_15754 | 287 |
| 25 | 3300042604 | Ga0466717_158033 | Ga0466717_158033_1749_2612 | 287 |
| 26 | 3300042608 | Ga0466721_251509 | Ga0466721_251509_134436_135299 | 287 |
| 27 | 3300042609 | Ga0466722_023977 | Ga0466722_023977_668_1531 | 287 |
| 28 | 3300042609 | Ga0466722_037673 | Ga0466722_037673_399_1262 | 287 |
| 29 | 3300042616 | Ga0466715_061408 | Ga0466715_061408_32317_33180 | 287 |
| 30 | 3300042617 | Ga0466718_011451 | Ga0466718_011451_440_1303 | 287 |
| 31 | 3300042619 | Ga0466726_460941 | Ga0466726_460941_2287_3150 | 287 |
| 32 | 3300042621 | Ga0466729_017964 | Ga0466729_017964_17851_18714 | 287 |
| 33 | 3300042624 | Ga0466735_040955 | Ga0466735_040955_616_1479 | 287 |
| 34 | 3300042624 | Ga0466735_122448 | Ga0466735_122448_4591_5454 | 287 |
| 35 | 3300042624 | Ga0466735_233438 | Ga0466735_233438_63724_64587 | 287 |
| 36 | 3300042636 | Ga0466703_226987 | Ga0466703_226987_777_1640 | 287 |
| 37 | 3300042659 | Ga0466733_181671 | Ga0466733_181671_360_1223 | 287 |
| 38 | iso_pr_bacteria | 2820001644 | 2820004042 | 287 |
| 39 | iso_pr_bacteria | 2820252425 | 2820252984 | 287 |
| 40 | iso_pr_bacteria | 2820265624 | 2820265741 | 287 |
| 41 | iso_pr_bacteria | 2820272499 | 2820274383 | 287 |
| 42 | iso_pr_bacteria | 2820277137 | 2820278605 | 287 |
| 43 | iso_pr_bacteria | 2820290662 | 2820291193 | 287 |
| 44 | iso_pr_bacteria | 2820318056 | 2820318944 | 287 |
| 45 | iso_pr_bacteria | 2820336130 | 2820338035 | 287 |
| 46 | iso_pr_bacteria | 2820362221 | 2820363556 | 287 |
| 47 | iso_pr_bacteria | 2820408893 | 2820409790 | 287 |
| 48 | iso_pr_bacteria | 2820499546 | 2820499835 | 287 |
| 49 | iso_pr_bacteria | 2820507989 | 2820509476 | 287 |
| 50 | iso_pr_bacteria | 2820537337 | 2820537595 | 287 |
| 51 | iso_pr_bacteria | 2820590132 | 2820591604 | 287 |
| 52 | iso_pr_bacteria | 2820602899 | 2820603539 | 287 |
| 53 | iso_pr_bacteria | 2820619171 | 2820620298 | 287 |
| 54 | iso_pr_bacteria | 2820654856 | 2820656817 | 287 |
| 55 | iso_pr_bacteria | 2820671341 | 2820671561 | 287 |
| 56 | iso_pr_bacteria | 2820681712 | 2820682483 | 287 |
| 57 | 2035265001 | GhopperDRAF_NODE_285309_len_3934_cov_6_886630 | GhopperDRAFT_70650 | 288 |
| 58 | 2225789004 | 2227219676 | 2227651673 | 288 |
| 59 | 2225789004 | 2227236341 | 2227674106 | 288 |
| 60 | 3300000062 | IMNBL1DRAFT_c0000688 | IMNBL1DRAFT_00006882 | 288 |
| 61 | 3300000062 | IMNBL1DRAFT_c0003403 | IMNBL1DRAFT_000340310 | 288 |
| 62 | 3300000062 | IMNBL1DRAFT_c0004887 | IMNBL1DRAFT_00048873 | 288 |
| 63 | 3300000062 | IMNBL1DRAFT_c0009138 | IMNBL1DRAFT_00091385 | 288 |
| 64 | 3300002450 | JGI24695J34938_10000824 | JGI24695J34938_1000082415 | 288 |
| 65 | 3300002504 | JGI24705J35276_12195640 | JGI24705J35276_121956401 | 288 |
| 66 | 3300005083 | Ga0068305_10126424 | Ga0068305_101264248 | 288 |
| 67 | 3300005201 | Ga0072941_1004700 | Ga0072941_100470014 | 288 |
| 68 | 3300005201 | Ga0072941_1090574 | Ga0072941_10905746 | 288 |
| 69 | 3300009826 | Ga0123355_10001408 | Ga0123355_1000140825 | 288 |
| 70 | 3300009826 | Ga0123355_10035635 | Ga0123355_100356356 | 288 |
| 71 | 3300009826 | Ga0123355_10053633 | Ga0123355_100536334 | 288 |
| 72 | 3300009826 | Ga0123355_10172454 | Ga0123355_101724543 | 288 |
| 73 | 3300009826 | Ga0123355_10175927 | Ga0123355_101759273 | 288 |
| 74 | 3300009826 | Ga0123355_10188125 | Ga0123355_101881253 | 288 |
| 75 | 3300009826 | Ga0123355_10257253 | Ga0123355_102572533 | 288 |
| 76 | 3300009826 | Ga0123355_10320308 | Ga0123355_103203082 | 288 |
| 77 | 3300009826 | Ga0123355_10335859 | Ga0123355_103358592 | 288 |
| 78 | 3300009826 | Ga0123355_10343279 | Ga0123355_103432792 | 288 |
| 79 | 3300009826 | Ga0123355_10387834 | Ga0123355_103878343 | 288 |
| 80 | 3300009826 | Ga0123355_10417966 | Ga0123355_104179661 | 288 |
| 81 | 3300009826 | Ga0123355_10422325 | Ga0123355_104223251 | 288 |
| 82 | 3300009826 | Ga0123355_10452877 | Ga0123355_104528772 | 288 |
| 83 | 3300009826 | Ga0123355_10917245 | Ga0123355_109172451 | 288 |
| 84 | 3300010049 | Ga0123356_10506138 | Ga0123356_105061381 | 288 |
| 85 | 3300010167 | Ga0123353_10151652 | Ga0123353_101516522 | 288 |
| 86 | 3300010167 | Ga0123353_10640531 | Ga0123353_106405312 | 288 |
| 87 | 3300010167 | Ga0123353_10721117 | Ga0123353_107211172 | 288 |
| 88 | 3300010882 | Ga0123354_10047859 | Ga0123354_100478595 | 288 |
| 89 | 3300010882 | Ga0123354_10288169 | Ga0123354_102881691 | 288 |
| 90 | 3300026558 | Ga0255576_1000003 | Ga0255576_1000003128 | 288 |
| 91 | 3300035363 | Ga0247289_2750 | Ga0247289_2750_34_900 | 288 |
| 92 | 3300042616 | Ga0466715_032155 | Ga0466715_032155_82085_82951 | 288 |
| 93 | 3300042649 | Ga0466724_52280 | Ga0466724_52280_14134_15000 | 288 |
| 94 | 3300042654 | Ga0466725_325126 | Ga0466725_325126_8737_9603 | 288 |
| 95 | 3300042659 | Ga0466733_169086 | Ga0466733_169086_107_973 | 288 |
| 96 | iso_pr_bacteria | 2788499854 | 2788759864 | 288 |
| 97 | iso_pr_bacteria | 2820551407 | 2820555198 | 288 |
| 98 | iso_pr_bacteria | 2834951433 | 2834951892 | 288 |
| 99 | iso_pr_bacteria | 2873581347 | 2873581446 | 288 |
| 100 | iso_pr_bacteria | 2940236825 | 2940238516 | 288 |
| 101 | iso_pr_bacteria | 2940339133 | 2940340957 | 288 |
| 102 | iso_pr_bacteria | 2940341480 | 2940343259 | 288 |
| 103 | iso_pr_bacteria | 2940343849 | 2940345626 | 288 |
| 104 | iso_pr_bacteria | 2940352027 | 2940352746 | 288 |
| 105 | iso_pr_bacteria | 2940354458 | 2940355177 | 288 |
| 106 | iso_pr_bacteria | 2940356891 | 2940357611 | 288 |
| 107 | iso_pr_bacteria | 2940359323 | 2940359967 | 288 |
| 108 | iso_pr_bacteria | 2940361758 | 2940362401 | 288 |
| 109 | iso_pr_bacteria | 2940364193 | 2940364912 | 288 |
| 110 | iso_pr_bacteria | 2940366561 | 2940367089 | 288 |
| 111 | iso_pr_bacteria | 2940368928 | 2940370455 | 288 |
| 112 | iso_pr_bacteria | 8002299145 | 8002303728 | 288 |
| 113 | 3300000062 | IMNBL1DRAFT_c0000174 | IMNBL1DRAFT_000017412 | 289 |
| 114 | 3300000062 | IMNBL1DRAFT_c0021955 | IMNBL1DRAFT_00219552 | 289 |
| 115 | 3300003097 | Ga0052191_103178 | Ga0052191_1031781 | 289 |
| 116 | 3300005313 | Ga0074307_1108422 | Ga0074307_11084222 | 289 |
| 117 | 3300007129 | Ga0102734_1000006 | Ga0102734_100000620 | 289 |
| 118 | 3300007901 | Ga0111035_101356 | Ga0111035_1013563 | 289 |
| 119 | 3300010167 | Ga0123353_10472719 | Ga0123353_104727192 | 289 |
| 120 | 3300042599 | Ga0466706_070845 | Ga0466706_070845_61_930 | 289 |
| 121 | 3300042599 | Ga0466706_078368 | Ga0466706_078368_61_930 | 289 |
| 122 | 3300042599 | Ga0466706_097710 | Ga0466706_097710_12419_13288 | 289 |
| 123 | 3300042599 | Ga0466706_105823 | Ga0466706_105823_24153_25022 | 289 |
| 124 | 3300042599 | Ga0466706_116573 | Ga0466706_116573_33852_34721 | 289 |
| 125 | 3300042599 | Ga0466706_117117 | Ga0466706_117117_944_1813 | 289 |
| 126 | 3300042599 | Ga0466706_130274 | Ga0466706_130274_2855_3724 | 289 |
| 127 | 3300042599 | Ga0466706_130551 | Ga0466706_130551_16368_17237 | 289 |
| 128 | 3300042599 | Ga0466706_132036 | Ga0466706_132036_207_1076 | 289 |
| 129 | 3300042599 | Ga0466706_154904 | Ga0466706_154904_74028_74897 | 289 |
| 130 | 3300042599 | Ga0466706_215257 | Ga0466706_215257_2277_3146 | 289 |
| 131 | 3300042599 | Ga0466706_238501 | Ga0466706_238501_188_1057 | 289 |
| 132 | 3300042599 | Ga0466706_274157 | Ga0466706_274157_165_1034 | 289 |
| 133 | 3300042603 | Ga0466714_032177 | Ga0466714_032177_30_899 | 289 |
| 134 | 3300042655 | Ga0466727_043933 | Ga0466727_043933_18_887 | 289 |
| 135 | 3300042654 | Ga0466725_460104 | Ga0466725_460104_2201_3073 | 290 |
| 136 | 3300042599 | Ga0466706_134420 | Ga0466706_134420_41288_42163 | 291 |
| 137 | 3300042654 | Ga0466725_268002 | Ga0466725_268002_4829_5704 | 291 |
| 138 | 3300009826 | Ga0123355_10257869 | Ga0123355_102578692 | 292 |
| 139 | 3300042599 | Ga0466706_004269 | Ga0466706_004269_122_1000 | 292 |
| 140 | 3300042599 | Ga0466706_246148 | Ga0466706_246148_24678_25556 | 292 |
| 141 | 3300042659 | Ga0466733_138139 | Ga0466733_138139_20926_21804 | 292 |
| 142 | 3300042603 | Ga0466714_139125 | Ga0466714_139125_3189_4070 | 293 |
| 143 | 3300042609 | Ga0466722_142744 | Ga0466722_142744_876_1766 | 296 |
| 144 | 3300009826 | Ga0123355_10006818 | Ga0123355_1000681815 | 301 |
| 145 | 3300042591 | Ga0466692_194805 | Ga0466692_194805_1203_2120 | 305 |
| 146 | 3300010167 | Ga0123353_10467761 | Ga0123353_104677612 | 309 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01116 | F_bP_aldolase | Fructose-bisphosphate aldolase class-II | 2 | 289 | 0.88 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.89 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.