Protein Family IF05521
Metagenome
Metatranscriptome
Isolate
449
Members
271
Samples
274
Scaffolds
156.7
Avg Length
Representative Sequence
- ID
- 3300042598|Ga0466701_086101|Ga0466701_086101_76_657
- Length
- 193 aa
- Sequence
- LISFFRRFPNSGEGNEKYLFFRVQYACAVFLAQEVVIMPRRGYGAKRTILPDPVYGDILVAKMIHAVMLQGKARVAERLVYGSLDILKEKTKEDPIAVLKKAIENAKPMVEVKSRRVGGATYQVPVEIRPERRLSLSIRWLVGYARSRGEKTMMTKLSGELLDAYNNRGVTIKKKEDTHKMAEANKAFAHYRW
Sample Types
Isolate
39.0%
Metagenome
60.6%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
30.4%
Unclassified
12.2%
Termitidae
11.0%
Formicidae
7.2%
Culicidae
5.3%
Kalotermitidae
5.3%
Elmidae
3.8%
Curculionidae
3.8%
Aleyrodidae
2.3%
Sarcophagidae
2.3%
Argasidae
1.5%
Ixodidae
1.5%
Drosophilidae
1.5%
Termopsidae
1.5%
Armadillidiidae
1.5%
Aphididae
1.5%
Rhinotermitidae
1.1%
Chrysomelidae
1.1%
Hydrophilidae
0.8%
Largidae
0.8%
Passalidae
0.8%
Berytidae
0.8%
Tenebrionidae
0.4%
Hodotermitidae
0.4%
Trigoniulidae
0.4%
Siricidae
0.4%
Alydidae
0.4%
Taxonomy
Archaea
0
Bacteria
345
Eukaryota
0
Viruses
0
Unclassified
104
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 2 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 3 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 4 | 2964145936 | Entomospira culicis BR149 | Isolate | Culicidae |
| 5 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 6 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 7 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 8 | 2775507261 | Borrelia turicatae 91E135 | Isolate | Argasidae |
| 9 | 3002462131 | Borrelia sp. A-FGy1 | Isolate | Ixodidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 12 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 15 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 16 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 17 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 25 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 26 | 8063587521 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 27 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 28 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 29 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 30 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 31 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 32 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 33 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 34 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 42 | 2964266314 | Entomospira nematocera BR208 | Isolate | Culicidae |
| 43 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 44 | 2820046858 | Unclassified Proteobacteria Th196P3bin84 | Isolate | Unclassified |
| 45 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 46 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 47 | 8114010755 | Borrelia coriaceae Co53 | Isolate | Argasidae |
| 48 | 2998829267 | Enterobacteriaceae endosymbiont of Macroplea mutica MmutSym | Isolate | Chrysomelidae |
| 49 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 50 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 51 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 52 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 53 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 54 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 55 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 56 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 57 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 58 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 59 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 60 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 61 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 62 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 63 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 64 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 65 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 66 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 67 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 68 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 69 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 70 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 71 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 72 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 73 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 74 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 75 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 76 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 77 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 78 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 79 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 80 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 81 | 2964130733 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 82 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 83 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 84 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 85 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 86 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 87 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 88 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 89 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 90 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 91 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 92 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 93 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 94 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 95 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 96 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 97 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 98 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 99 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 100 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 101 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 102 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 103 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 104 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 105 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 106 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 107 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 108 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 109 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 110 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 111 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 112 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 113 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 114 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 115 | 2515154046 | Candidatus Portiera aleyrodidarum | Isolate | Aleyrodidae |
| 116 | 2518285589 | Candidatus Portiera aleyrodidarum TV (unscreened) | Isolate | Aleyrodidae |
| 117 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 118 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 119 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 120 | 2565956565 | Borrelia coriaceae Co53 | Isolate | Argasidae |
| 121 | 2998829729 | Enterobacteriaceae endosymbiont of Donacia sparganii DsparSym | Isolate | Chrysomelidae |
| 122 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 123 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 124 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 125 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 126 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 127 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 128 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 129 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 130 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 131 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 132 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 133 | 8063595521 | Entomospira culicis BR149 | Isolate | Culicidae |
| 134 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 135 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 136 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 137 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 138 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 139 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 140 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 141 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 142 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 143 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 144 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 145 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 146 | 2884497005 | Buchnera aphidicola BuCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 147 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 148 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 149 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 150 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 151 | 2545555866 | Borrelia coriaceae ATCC 43381 | Isolate | Argasidae |
| 152 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 153 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 154 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 155 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 156 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 157 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 158 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 159 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 160 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 161 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 162 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 163 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 164 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 165 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 166 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 167 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 168 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 169 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 170 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 171 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 172 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 173 | 2848878685 | Borrelia miyamotoi CA17-2241 | Isolate | Ixodidae |
| 174 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 175 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 176 | 2820025825 | Unclassified Spirochaetes Lab288P1bin8 | Isolate | Unclassified |
| 177 | 2718218422 | Borrelia miyamotoi CT13-2396 | Isolate | Ixodidae |
| 178 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 179 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 180 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 181 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 182 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 183 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 184 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 185 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 186 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 187 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 188 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 189 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 190 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 191 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 192 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 193 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 194 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 195 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 196 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 197 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 198 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 199 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 200 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 201 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 202 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 203 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 204 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 205 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 206 | 2964144231 | Entomospira culicis BR151 | Isolate | Culicidae |
| 207 | 2887836388 | Buchnera aphidicola BuCisplendens/3004 | Isolate | Aphididae |
| 208 | 2518645538 | Candidatus Portiera aleyrodidarum BT-QVLC | Isolate | Aleyrodidae |
| 209 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 210 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 211 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 212 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 213 | 2512047025 | Candidatus Portiera aleyrodidarum | Isolate | Aleyrodidae |
| 214 | 2998831142 | Enterobacteriaceae endosymbiont of Macroplea appendiculata MappSym | Isolate | Chrysomelidae |
| 215 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 216 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 217 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 218 | 3300021220 | Termite gut microbial communities from nest from French Guiana - FG16_9_6 mRNA SA | Metatranscriptome | |
| 219 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 220 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 221 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 222 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 223 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 224 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 225 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 226 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 227 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 228 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 229 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 230 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 231 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 232 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 233 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 234 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 235 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 236 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 237 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 238 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 239 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 240 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 241 | 2881226535 | Candidatus Borreliella tachyglossi Bc-F10-1268 | Isolate | Ixodidae |
| 242 | 2517093038 | Candidatus Portiera aleyrodidarum BT-B | Isolate | Aleyrodidae |
| 243 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 244 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 245 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 246 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 247 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 248 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 249 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 250 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 251 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 252 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 253 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 254 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 255 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 256 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 257 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 258 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 259 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 260 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 261 | 8063589291 | Entomospira nematocera BR208 | Isolate | Culicidae |
| 262 | 8063597228 | Entomospira culicis BR151 | Isolate | Culicidae |
| 263 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 264 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 265 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 266 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 267 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 268 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 269 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 270 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 271 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562376_2805 | 3300056857 | Bacteria | 19471 |
| 2 | JGI24698J34947_10062237 | 3300002449 | Unclassified | 1833 |
| 3 | JGI24695J34938_10041847 | 3300002450 | Bacteria | 2054 |
| 4 | Meta3P_1000450 | 3300002464 | Unclassified | 37605 |
| 5 | JGI24705J35276_12238062 | 3300002504 | Unclassified | 15442 |
| 6 | CVPL005L_10019399 | 3300002938 | Unclassified | 3622 |
| 7 | Ga0068302_10096828 | 3300005071 | Unclassified | 3174 |
| 8 | Ga0072941_1611805 | 3300005201 | Bacteria | 867 |
| 9 | Ga0102734_1021997 | 3300007129 | Unclassified | 2184 |
| 10 | Ga0103260_1011699 | 3300007139 | Unclassified | 1220 |
| 11 | Ga0102737_1002392 | 3300007142 | Unclassified | 4672 |
| 12 | Ga0104048_1171961 | 3300007143 | Bacteria | 1400 |
| 13 | Ga0103264_1000735 | 3300007188 | Bacteria | 15837 |
| 14 | Ga0123356_11407056 | 3300010049 | Unclassified | 858 |
| 15 | Ga0123353_10923176 | 3300010167 | Unclassified | 1185 |
| 16 | Ga0123354_10091931 | 3300010882 | Bacteria | 4186 |
| 17 | Ga0466710_410828 | 3300042613 | Unclassified | 8169 |
| 18 | Ga0466712_076827 | 3300042614 | Unclassified | 6364 |
| 19 | Ga0466711_075373 | 3300042615 | Bacteria | 27057 |
| 20 | Ga0466734_068006 | 3300042623 | Bacteria | 17982 |
| 21 | Ga0466734_097712 | 3300042623 | Unclassified | 2113 |
| 22 | Ga0466730_095496 | 3300042625 | Bacteria | 4491 |
| 23 | Ga0466702_188625 | 3300042635 | Bacteria | 3164 |
| 24 | Ga0466703_204118 | 3300042636 | Unclassified | 1455 |
| 25 | Ga0466703_254337 | 3300042636 | Unclassified | 1650 |
| 26 | Ga0466703_282901 | 3300042636 | Bacteria | 9455 |
| 27 | Ga0466709_204570 | 3300042648 | Unclassified | 4839 |
| 28 | Ga0466706_126350 | 3300042599 | Bacteria | 3079 |
| 29 | Ga0466717_000436 | 3300042604 | Bacteria | 2427 |
| 30 | Ga0466717_146244 | 3300042604 | Unclassified | 5775 |
| 31 | Ga0466697_049927 | 3300042611 | Unclassified | 1007 |
| 32 | Ga0160459_100090 | 3300012831 | Unclassified | 101126 |
| 33 | Ga0160430_116020 | 3300012852 | Unclassified | 1122 |
| 34 | Ga0160457_1030586 | 3300012858 | Bacteria | 741 |
| 35 | Ga0264413_105507 | 3300024493 | Bacteria | 126830 |
| 36 | Ga0466657_063027 | 3300042582 | Unclassified | 2576 |
| 37 | Ga0466657_108160 | 3300042582 | Bacteria | 16433 |
| 38 | Ga0466657_110876 | 3300042582 | Bacteria | 19718 |
| 39 | Ga0466690_037865 | 3300042590 | Bacteria | 3295 |
| 40 | Ga0466691_139307 | 3300042593 | Bacteria | 4831 |
| 41 | Ga0466691_189154 | 3300042593 | Bacteria | 12605 |
| 42 | Ga0466696_239406 | 3300042596 | Bacteria | 3810 |
| 43 | Ga0466701_002963 | 3300042598 | Unclassified | 3096 |
| 44 | CVPL010W_10047509 | 3300002931 | Unclassified | 1095 |
| 45 | CVPL005W_1000597 | 3300002934 | Unclassified | 13478 |
| 46 | Ga0068305_10078916 | 3300005083 | Bacteria | 9852 |
| 47 | Ga0072941_1588742 | 3300005201 | Bacteria | 1008 |
| 48 | Ga0103267_1005552 | 3300007190 | Unclassified | 3527 |
| 49 | Ga0123357_10005090 | 3300009784 | Bacteria | 15663 |
| 50 | Ga0123356_10462169 | 3300010049 | Bacteria | 1419 |
| 51 | Ga0123353_10041577 | 3300010167 | Bacteria | 7263 |
| 52 | Ga0123354_10358380 | 3300010882 | Unclassified | 1289 |
| 53 | Ga0466710_098777 | 3300042613 | Unclassified | 4453 |
| 54 | Ga0466710_155272 | 3300042613 | Bacteria | 15343 |
| 55 | Ga0466710_300492 | 3300042613 | Unclassified | 1775 |
| 56 | Ga0466710_323517 | 3300042613 | Unclassified | 1717 |
| 57 | Ga0466710_368990 | 3300042613 | Bacteria | 2869 |
| 58 | Ga0466711_067112 | 3300042615 | Bacteria | 2569 |
| 59 | Ga0466715_335395 | 3300042616 | Unclassified | 4934 |
| 60 | Ga0466715_560345 | 3300042616 | Bacteria | 3326 |
| 61 | Ga0466723_141570 | 3300042618 | Bacteria | 16038 |
| 62 | Ga0466729_107487 | 3300042621 | Bacteria | 21413 |
| 63 | Ga0466730_025166 | 3300042625 | Bacteria | 34324 |
| 64 | Ga0466724_30562 | 3300042649 | Bacteria | 18652 |
| 65 | Ga0466708_132864 | 3300042652 | Unclassified | 3022 |
| 66 | Ga0466727_295972 | 3300042655 | Bacteria | 1521 |
| 67 | Ga0466701_048315 | 3300042598 | Unclassified | 2779 |
| 68 | Ga0466707_069769 | 3300042601 | Unclassified | 3982 |
| 69 | Ga0466719_140794 | 3300042606 | Bacteria | 12760 |
| 70 | Ga0466721_271329 | 3300042608 | Bacteria | 2311 |
| 71 | Ga0466721_394519 | 3300042608 | Bacteria | 3285 |
| 72 | Ga0466722_170339 | 3300042609 | Bacteria | 3474 |
| 73 | Ga0160468_100140 | 3300012819 | Bacteria | 68314 |
| 74 | Ga0160456_100454 | 3300012820 | Bacteria | 13332 |
| 75 | Ga0466692_175558 | 3300042591 | Bacteria | 16086 |
| 76 | Ga0466693_345351 | 3300042592 | Unclassified | 2432 |
| 77 | Ga0466691_214949 | 3300042593 | Unclassified | 1821 |
| 78 | Ga0466699_366116 | 3300042597 | Bacteria | 1012 |
| 79 | Ga0466705_101405 | 3300042612 | Bacteria | 2409 |
| 80 | Ga0103265_1004504 | 3300007068 | Unclassified | 2777 |
| 81 | Ga0102739_1011686 | 3300007095 | Bacteria | 1133 |
| 82 | Ga0102738_1000044 | 3300007141 | Bacteria | 91568 |
| 83 | Ga0103264_1000059 | 3300007188 | Bacteria | 64034 |
| 84 | Ga0103264_1001190 | 3300007188 | Unclassified | 11515 |
| 85 | Ga0105005_1109541 | 3300007505 | Unclassified | 2099 |
| 86 | Ga0123357_10308256 | 3300009784 | Unclassified | 1586 |
| 87 | Ga0123354_10006260 | 3300010882 | Bacteria | 17634 |
| 88 | Ga0123354_10243723 | 3300010882 | Unclassified | 1841 |
| 89 | Ga0466710_046595 | 3300042613 | Bacteria | 1990 |
| 90 | Ga0466710_152397 | 3300042613 | Unclassified | 2535 |
| 91 | Ga0466723_113112 | 3300042618 | Bacteria | 15978 |
| 92 | Ga0466726_066823 | 3300042619 | Bacteria | 1175 |
| 93 | Ga0466726_397448 | 3300042619 | Unclassified | 1121 |
| 94 | Ga0466734_117554 | 3300042623 | Unclassified | 1910 |
| 95 | Ga0466701_051312 | 3300042598 | Bacteria | 1920 |
| 96 | Ga0466701_063590 | 3300042598 | Bacteria | 8157 |
| 97 | Ga0466717_156267 | 3300042604 | Bacteria | 3386 |
| 98 | Ga0466716_258051 | 3300042605 | Bacteria | 1177 |
| 99 | Ga0466716_400870 | 3300042605 | Unclassified | 2718 |
| 100 | Ga0466722_158794 | 3300042609 | Bacteria | 2906 |
| 101 | Ga0160434_120566 | 3300012850 | Unclassified | 1006 |
| 102 | Ga0233288_1026303 | 3300022232 | Bacteria | 662 |
| 103 | Ga0466657_010228 | 3300042582 | Unclassified | 1192 |
| 104 | Ga0466657_072844 | 3300042582 | Unclassified | 10951 |
| 105 | Ga0466692_112435 | 3300042591 | Bacteria | 72698 |
| 106 | Ga0466692_139279 | 3300042591 | Bacteria | 3787 |
| 107 | Ga0466696_023744 | 3300042596 | Unclassified | 2551 |
| 108 | Ga0072941_1082500 | 3300005201 | Bacteria | 10708 |
| 109 | Ga0102734_1003144 | 3300007129 | Unclassified | 3772 |
| 110 | Ga0102740_1000529 | 3300007140 | Bacteria | 10479 |
| 111 | Ga0104050_1201052 | 3300007153 | Unclassified | 1963 |
| 112 | Ga0123356_10053504 | 3300010049 | Unclassified | 3758 |
| 113 | Ga0160454_101544 | 3300012798 | Bacteria | 3249 |
| 114 | Ga0466710_304130 | 3300042613 | Unclassified | 7101 |
| 115 | Ga0466711_489348 | 3300042615 | Bacteria | 24378 |
| 116 | Ga0466723_253454 | 3300042618 | Bacteria | 6189 |
| 117 | Ga0466728_450402 | 3300042620 | Bacteria | 3371 |
| 118 | Ga0466734_098099 | 3300042623 | Bacteria | 4839 |
| 119 | Ga0466735_038759 | 3300042624 | Unclassified | 2115 |
| 120 | Ga0466704_608928 | 3300042643 | Bacteria | 18017 |
| 121 | Ga0466724_45911 | 3300042649 | Bacteria | 295309 |
| 122 | Ga0466708_091916 | 3300042652 | Bacteria | 16617 |
| 123 | Ga0466725_007764 | 3300042654 | Bacteria | 15372 |
| 124 | Ga0466725_187630 | 3300042654 | Unclassified | 20718 |
| 125 | Ga0466725_254475 | 3300042654 | Bacteria | 15064 |
| 126 | Ga0466701_095081 | 3300042598 | Bacteria | 29674 |
| 127 | Ga0466706_113809 | 3300042599 | Unclassified | 3295 |
| 128 | Ga0466719_276879 | 3300042606 | Bacteria | 1180 |
| 129 | Ga0160440_100376 | 3300012815 | Bacteria | 18225 |
| 130 | Ga0160460_106866 | 3300012845 | Bacteria | 1534 |
| 131 | Ga0466656_067420 | 3300042550 | Bacteria | 7732 |
| 132 | Ga0466690_012085 | 3300042590 | Bacteria | 20404 |
| 133 | Ga0466696_370270 | 3300042596 | Bacteria | 1132 |
| 134 | Ga0466701_014141 | 3300042598 | Bacteria | 3164 |
| 135 | Ga0466697_144933 | 3300042611 | Unclassified | 1812 |
| 136 | SWWA_contig32024__length_2940___numreads_140 | 2100351016 | Unclassified | 2940 |
| 137 | 2227136669 | 2225789004 | Bacteria | 1638 |
| 138 | CVPL010W_10000415 | 3300002931 | Bacteria | 63715 |
| 139 | Ga0103266_1039444 | 3300007067 | Bacteria | 608 |
| 140 | Ga0102739_1015750 | 3300007095 | Bacteria | 974 |
| 141 | Ga0102734_1003200 | 3300007129 | Unclassified | 3737 |
| 142 | Ga0103268_1001421 | 3300007192 | Bacteria | 5960 |
| 143 | Ga0103268_1002801 | 3300007192 | Bacteria | 3778 |
| 144 | Ga0123357_10000131 | 3300009784 | Bacteria | 64937 |
| 145 | Ga0123356_10768835 | 3300010049 | Bacteria | 1134 |
| 146 | Ga0123353_11116197 | 3300010167 | Unclassified | 1045 |
| 147 | Ga0466710_164766 | 3300042613 | Bacteria | 1641 |
| 148 | Ga0466710_191520 | 3300042613 | Bacteria | 38985 |
| 149 | Ga0466715_557112 | 3300042616 | Unclassified | 9662 |
| 150 | Ga0466729_142034 | 3300042621 | Unclassified | 1351 |
| 151 | Ga0466729_190917 | 3300042621 | Bacteria | 3833 |
| 152 | Ga0466729_192468 | 3300042621 | Unclassified | 1638 |
| 153 | Ga0466734_163443 | 3300042623 | Unclassified | 3628 |
| 154 | Ga0466730_009947 | 3300042625 | Bacteria | 4306 |
| 155 | Ga0466709_282914 | 3300042648 | Unclassified | 4297 |
| 156 | Ga0466708_172536 | 3300042652 | Bacteria | 3851 |
| 157 | Ga0466725_177549 | 3300042654 | Bacteria | 23061 |
| 158 | Ga0466725_322912 | 3300042654 | Unclassified | 2477 |
| 159 | Ga0466727_288220 | 3300042655 | Bacteria | 2025 |
| 160 | Ga0466701_020536 | 3300042598 | Bacteria | 6794 |
| 161 | Ga0466701_072983 | 3300042598 | Bacteria | 4370 |
| 162 | Ga0466701_082355 | 3300042598 | Bacteria | 7742 |
| 163 | Ga0466701_086101 | 3300042598 | Bacteria | 1172 |
| 164 | Ga0466716_084628 | 3300042605 | Bacteria | 13106 |
| 165 | Ga0466719_022036 | 3300042606 | Unclassified | 2144 |
| 166 | Ga0466722_193669 | 3300042609 | Bacteria | 2619 |
| 167 | Ga0160458_102892 | 3300012832 | Unclassified | 2240 |
| 168 | Ga0466656_095289 | 3300042550 | Unclassified | 4600 |
| 169 | Ga0466657_233653 | 3300042582 | Bacteria | 7764 |
| 170 | Ga0466699_377150 | 3300042597 | Unclassified | 1800 |
| 171 | Ga0466733_211964 | 3300042659 | Unclassified | 14614 |
| 172 | CVPL010W_10000688 | 3300002931 | Bacteria | 37286 |
| 173 | CVPL005L_10000364 | 3300002938 | Bacteria | 63119 |
| 174 | Ga0103263_100409 | 3300007042 | Unclassified | 5856 |
| 175 | Ga0103260_1007010 | 3300007139 | Unclassified | 1603 |
| 176 | Ga0103264_1002042 | 3300007188 | Unclassified | 9013 |
| 177 | Ga0123357_10071309 | 3300009784 | Bacteria | 4607 |
| 178 | Ga0123357_10408178 | 3300009784 | Unclassified | 1227 |
| 179 | Ga0123355_10935130 | 3300009826 | Unclassified | 934 |
| 180 | Ga0123356_10024666 | 3300010049 | Bacteria | 5657 |
| 181 | Ga0123353_10003262 | 3300010167 | Bacteria | 20474 |
| 182 | Ga0466711_188397 | 3300042615 | Bacteria | 30134 |
| 183 | Ga0466711_409809 | 3300042615 | Unclassified | 4117 |
| 184 | Ga0466711_434904 | 3300042615 | Unclassified | 3524 |
| 185 | Ga0466715_010316 | 3300042616 | Unclassified | 2806 |
| 186 | Ga0466715_351992 | 3300042616 | Bacteria | 6616 |
| 187 | Ga0466715_452321 | 3300042616 | Bacteria | 3603 |
| 188 | Ga0466728_413749 | 3300042620 | Bacteria | 3493 |
| 189 | Ga0466734_151181 | 3300042623 | Bacteria | 6497 |
| 190 | Ga0466730_021318 | 3300042625 | Bacteria | 9729 |
| 191 | Ga0466703_071448 | 3300042636 | Unclassified | 5843 |
| 192 | Ga0466724_04111 | 3300042649 | Bacteria | 4094 |
| 193 | Ga0466708_039955 | 3300042652 | Bacteria | 13026 |
| 194 | Ga0466701_031276 | 3300042598 | Bacteria | 18234 |
| 195 | Ga0466700_360136 | 3300042600 | Bacteria | 2490 |
| 196 | Ga0466707_121886 | 3300042601 | Unclassified | 3357 |
| 197 | Ga0466713_018886 | 3300042602 | Bacteria | 29657 |
| 198 | Ga0466716_430325 | 3300042605 | Bacteria | 1615 |
| 199 | Ga0466719_242775 | 3300042606 | Bacteria | 12133 |
| 200 | Ga0466719_382448 | 3300042606 | Unclassified | 3787 |
| 201 | Ga0466722_120902 | 3300042609 | Bacteria | 15763 |
| 202 | Ga0160440_100354 | 3300012815 | Bacteria | 19910 |
| 203 | Ga0160433_100967 | 3300012846 | Unclassified | 9483 |
| 204 | Ga0466692_011966 | 3300042591 | Bacteria | 3192 |
| 205 | Ga0466697_226889 | 3300042611 | Bacteria | 7686 |
| 206 | Ga0466733_029405 | 3300042659 | Bacteria | 6171 |
| 207 | CVPL010W_10008038 | 3300002931 | Bacteria | 10115 |
| 208 | CVPL010L_1037386 | 3300002932 | Bacteria | 818 |
| 209 | CVPL005L_10002197 | 3300002938 | Bacteria | 22446 |
| 210 | Ga0068302_10078241 | 3300005071 | Bacteria | 1483 |
| 211 | Ga0103266_1000843 | 3300007067 | Bacteria | 11132 |
| 212 | Ga0103261_1024622 | 3300007083 | Unclassified | 855 |
| 213 | Ga0103260_1000189 | 3300007139 | Unclassified | 13577 |
| 214 | Ga0103264_1000855 | 3300007188 | Bacteria | 45110 |
| 215 | Ga0123357_10017934 | 3300009784 | Bacteria | 9392 |
| 216 | Ga0466711_026046 | 3300042615 | Unclassified | 5067 |
| 217 | Ga0466726_026494 | 3300042619 | Unclassified | 4087 |
| 218 | Ga0466726_401459 | 3300042619 | Unclassified | 4692 |
| 219 | Ga0466726_421466 | 3300042619 | Bacteria | 1034 |
| 220 | Ga0466729_206501 | 3300042621 | Bacteria | 7133 |
| 221 | Ga0466734_132748 | 3300042623 | Bacteria | 6983 |
| 222 | Ga0466703_141231 | 3300042636 | Bacteria | 3835 |
| 223 | Ga0466704_249278 | 3300042643 | Unclassified | 1119 |
| 224 | Ga0466727_094798 | 3300042655 | Bacteria | 14324 |
| 225 | Ga0466706_068241 | 3300042599 | Bacteria | 1065 |
| 226 | Ga0466707_188233 | 3300042601 | Bacteria | 2710 |
| 227 | Ga0466717_111871 | 3300042604 | Bacteria | 1346 |
| 228 | Ga0223680_125430 | 3300021220 | Bacteria | 730 |
| 229 | Ga0466656_080906 | 3300042550 | Bacteria | 1921 |
| 230 | Ga0466656_172113 | 3300042550 | Bacteria | 6531 |
| 231 | Ga0466657_041916 | 3300042582 | Unclassified | 2109 |
| 232 | Ga0466657_305024 | 3300042582 | Bacteria | 1398 |
| 233 | Ga0466693_232336 | 3300042592 | Unclassified | 1812 |
| 234 | Ga0466691_164950 | 3300042593 | Unclassified | 3687 |
| 235 | Ga0466696_444231 | 3300042596 | Bacteria | 3285 |
| 236 | Ga0466705_373160 | 3300042612 | Bacteria | 25790 |
| 237 | Ga0466727_351649 | 3300042655 | Bacteria | 2548 |
| 238 | SPBB_contig11660 | 2044078006 | Bacteria | 5420 |
| 239 | IMNBL1DRAFT_c0037084 | 3300000062 | Bacteria | 1694 |
| 240 | JGI24702J35022_10134329 | 3300002462 | Bacteria | 1375 |
| 241 | Ga0102736_1001668 | 3300007052 | Bacteria | 5106 |
| 242 | Ga0103265_1005604 | 3300007068 | Bacteria | 1725 |
| 243 | Ga0102737_1000212 | 3300007142 | Unclassified | 19963 |
| 244 | Ga0104019_1197383 | 3300007150 | Unclassified | 1081 |
| 245 | Ga0103264_1007422 | 3300007188 | Bacteria | 5295 |
| 246 | Ga0103264_1014573 | 3300007188 | Unclassified | 3860 |
| 247 | Ga0103268_1000274 | 3300007192 | Bacteria | 18089 |
| 248 | Ga0123356_10828516 | 3300010049 | Bacteria | 1096 |
| 249 | Ga0123353_11135617 | 3300010167 | Bacteria | 1033 |
| 250 | Ga0466710_014798 | 3300042613 | Bacteria | 1735 |
| 251 | Ga0466718_004031 | 3300042617 | Unclassified | 1052 |
| 252 | Ga0466726_161542 | 3300042619 | Bacteria | 15067 |
| 253 | Ga0466729_165185 | 3300042621 | Bacteria | 4177 |
| 254 | Ga0466730_080574 | 3300042625 | Bacteria | 51807 |
| 255 | Ga0466703_003977 | 3300042636 | Unclassified | 9974 |
| 256 | Ga0466704_571957 | 3300042643 | Bacteria | 15856 |
| 257 | Ga0466709_287529 | 3300042648 | Unclassified | 1380 |
| 258 | Ga0466725_066371 | 3300042654 | Unclassified | 7930 |
| 259 | Ga0466725_067311 | 3300042654 | Unclassified | 2404 |
| 260 | Ga0466706_006948 | 3300042599 | Bacteria | 3450 |
| 261 | Ga0466706_141294 | 3300042599 | Bacteria | 1586 |
| 262 | Ga0466700_195716 | 3300042600 | Unclassified | 1315 |
| 263 | Ga0466707_032892 | 3300042601 | Bacteria | 15973 |
| 264 | Ga0466713_006507 | 3300042602 | Unclassified | 3603 |
| 265 | Ga0466713_084094 | 3300042602 | Bacteria | 6958 |
| 266 | Ga0466717_095871 | 3300042604 | Bacteria | 4902 |
| 267 | Ga0466719_036441 | 3300042606 | Bacteria | 4212 |
| 268 | Ga0466722_143420 | 3300042609 | Bacteria | 3319 |
| 269 | Ga0466657_248685 | 3300042582 | Unclassified | 15465 |
| 270 | Ga0466690_402677 | 3300042590 | Unclassified | 2241 |
| 271 | Ga0466692_132486 | 3300042591 | Bacteria | 3764 |
| 272 | Ga0466692_165459 | 3300042591 | Unclassified | 10466 |
| 273 | Ga0466694_212050 | 3300042594 | Bacteria | 7321 |
| 274 | Ga0466696_360510 | 3300042596 | Bacteria | 2403 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00177 | Ribosomal_S7 | Ribosomal protein S7p/S5e | 40 | 186 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.