Protein Family IF05509

Metagenome Isolate
183 Members
87 Samples
145 Scaffolds
326.68 Avg Length

🧬 Representative Sequence

ID
3300042598|Ga0466701_073991|Ga0466701_073991_275_1417
Length
380 aa
Sequence
MNNTKKSAGAKLREISKYSDRQIKKYEKLKKRKNIPEHEYLTKMRDENNLVEFDNVCTWFFTDVGTVRAVDGVSFDIPKGKTIGIVGESGCGKSVTSLSLMRLVHAPTGQIVSGEIRYNTGKKAVDITKLPIKEMQKIRGNEIGMIFQEPMTSLNPVFTIGMQIDEAIKLHNPKMTKADVKNRTLEMLDLVGIAEGVRIYKCYPHELSGGMRQRVMIAMTLACDPQLIIADEPTTALDVTIQAQILDLLRGLKDKINASIMLITHDLGVVAEMADYVAVMYAGRIIEKGTAEDIFLNPSHPYTVGLMESKPVVGREVDKLYSIPGNVPNPINLTDNCYFHGRCEKCTDKCAGVYPPLVKLSETHYVACYLYEKSEEAGIK

πŸ“Š Sample Types

Isolate 20.8%
Metagenome 79.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 24.4%
Termitidae 18.3%
Kalotermitidae 15.9%
Anthocoridae 13.4%
Drosophilidae 6.1%
Apidae 3.7%
Termopsidae 3.7%
Culicidae 2.4%
Rhinotermitidae 2.4%
Curculionidae 2.4%
Cerambycidae 1.2%
Daphniidae 1.2%
Hodotermitidae 1.2%
Crambidae 1.2%
Formicidae 1.2%
Tephritidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 176
Eukaryota 0
Viruses 0
Unclassified 7

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
2 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
3 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
4 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
5 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
6 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
7 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
8 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
13 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
14 2556921669 Shinella sp. DD12 Isolate Daphniidae
15 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
16 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
26 2937735258 Serratia marcescens KZ11 Isolate Apidae
27 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
28 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
29 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
30 650716102 Treponema primitia ZAS-2 Isolate Unclassified
31 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
32 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
33 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
34 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
35 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
36 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
37 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
40 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
43 8004541719 Serratia marcescens KZ19 Isolate Apidae
44 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
45 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
46 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
47 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
48 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
49 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
50 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
51 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
52 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
53 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
54 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
55 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
56 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
57 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
58 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
59 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
60 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
61 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
62 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
63 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
64 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
65 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
66 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
67 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
68 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
69 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
70 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
71 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
72 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
73 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
74 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
75 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
76 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
77 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
78 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
79 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
80 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
81 2978161719 Serratia marcescens KZ2 Isolate Apidae
82 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
83 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
84 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
85 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
86 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
87 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_090843 3300042636 Bacteria 17357
2 Ga0466703_350882 3300042636 Bacteria 30976
3 Ga0466709_350948 3300042648 Bacteria 3595
4 Ga0466708_174695 3300042652 Bacteria 8211
5 Ga0466708_337754 3300042652 Bacteria 2288
6 Ga0466727_220926 3300042655 Bacteria 3248
7 Ga0466701_073991 3300042598 Bacteria 3946
8 Ga0466707_183098 3300042601 Bacteria 6584
9 Ga0466707_242645 3300042601 Bacteria 2280
10 Ga0160460_100583 3300012845 Bacteria 19381
11 Ga0466696_482005 3300042596 Bacteria 2867
12 Ga0466726_282184 3300042619 Bacteria 2137
13 Ga0123355_10446366 3300009826 Unclassified 1634
14 Ga0123354_10031700 3300010882 Bacteria 8289
15 Ga0068305_10032434 3300005083 Bacteria 12413
16 Ga0074188_1155342 3300005318 Unclassified 2505
17 Ga0466705_338122 3300042612 Unclassified 4488
18 Ga0466705_357061 3300042612 Bacteria 9440
19 Ga0466730_051123 3300042625 Bacteria 1768
20 Ga0466724_60676 3300042649 Bacteria 15603
21 Ga0466727_256350 3300042655 Bacteria 2226
22 Ga0466701_076813 3300042598 Bacteria 1187
23 Ga0466705_436802 3300042612 Bacteria 4181
24 Ga0466705_445934 3300042612 Unclassified 12171
25 Ga0466711_477203 3300042615 Bacteria 5711
26 Ga0466715_115792 3300042616 Bacteria 5940
27 Ga0466715_592399 3300042616 Bacteria 7943
28 Ga0466723_075373 3300042618 Bacteria 14423
29 Ga0466723_124748 3300042618 Bacteria 48807
30 Ga0466723_229569 3300042618 Bacteria 135891
31 Ga0466729_168296 3300042621 Bacteria 14413
32 Ga0072941_1055919 3300005201 Bacteria 2589
33 Ga0466705_060583 3300042612 Bacteria 8881
34 Ga0466735_171057 3300042624 Bacteria 3362
35 Ga0466703_144769 3300042636 Bacteria 15489
36 Ga0466703_396491 3300042636 Bacteria 1341
37 Ga0466704_599969 3300042643 Bacteria 3136
38 Ga0466709_128248 3300042648 Bacteria 15847
39 Ga0466708_212877 3300042652 Bacteria 79784
40 Ga0466727_018589 3300042655 Bacteria 4752
41 Ga0466707_040886 3300042601 Bacteria 2234
42 Ga0466710_227767 3300042613 Bacteria 3635
43 Ga0466711_365712 3300042615 Bacteria 11698
44 Ga0466715_387864 3300042616 Bacteria 3864
45 Ga0466723_325522 3300042618 Bacteria 2393
46 Ga0466726_472030 3300042619 Bacteria 2127
47 Ga0123356_10001750 3300010049 Bacteria 23645
48 Ga0072941_1053289 3300005201 Bacteria 8060
49 Ga0466704_564685 3300042643 Bacteria 2216
50 Ga0466708_036939 3300042652 Bacteria 61265
51 Ga0466708_127935 3300042652 Bacteria 47397
52 Ga0466708_166272 3300042652 Bacteria 9227
53 Ga0466700_382545 3300042600 Bacteria 1549
54 Ga0466719_121509 3300042606 Bacteria 9880
55 Ga0160459_101021 3300012831 Unclassified 8055
56 Ga0466693_052064 3300042592 Bacteria 3693
57 Ga0466691_220219 3300042593 Bacteria 11339
58 Ga0466696_283887 3300042596 Bacteria 5235
59 Ga0466710_392314 3300042613 Bacteria 2167
60 Ga0466711_080340 3300042615 Bacteria 24032
61 Ga0466715_071976 3300042616 Bacteria 10748
62 Ga0466715_115286 3300042616 Bacteria 1295
63 Ga0466726_127382 3300042619 Bacteria 2562
64 Ga0466726_174079 3300042619 Bacteria 1465
65 Ga0466726_207182 3300042619 Bacteria 2000
66 Ga0466726_408992 3300042619 Bacteria 10187
67 Ga0466729_136603 3300042621 Bacteria 2294
68 Ga0123355_10000256 3300009826 Bacteria 68389
69 Ga0123355_10554887 3300009826 Bacteria 1387
70 Ga0123353_10099342 3300010167 Bacteria 4691
71 Ga0123353_10108646 3300010167 Bacteria 4470
72 Ga0123353_10176735 3300010167 Bacteria 3384
73 Ga0068305_10139106 3300005083 Bacteria 2614
74 Ga0074188_1000227 3300005318 Bacteria 41018
75 Ga0466703_276839 3300042636 Bacteria 11164
76 Ga0466709_219168 3300042648 Bacteria 5747
77 Ga0466713_088818 3300042602 Bacteria 57755
78 Ga0466716_001642 3300042605 Bacteria 6215
79 Ga0265387_1000090 3300024582 Bacteria 26311
80 Ga0466691_037135 3300042593 Bacteria 21121
81 Ga0466691_196931 3300042593 Bacteria 3907
82 Ga0466705_435943 3300042612 Bacteria 6354
83 Ga0466705_445601 3300042612 Bacteria 7301
84 Ga0466711_284014 3300042615 Bacteria 19361
85 Ga0466715_133461 3300042616 Bacteria 84152
86 Ga0466723_112275 3300042618 Bacteria 1829
87 Ga0466726_186879 3300042619 Bacteria 19791
88 Ga0123355_10678160 3300009826 Bacteria 1192
89 Ga0123356_10564788 3300010049 Bacteria 1300
90 Ga0123353_10001138 3300010167 Bacteria 32380
91 Ga0123353_10283878 3300010167 Bacteria 2540
92 Ga0123353_10343068 3300010167 Bacteria 2255
93 Ga0123353_11026922 3300010167 Bacteria 1104
94 Ga0123354_10356716 3300010882 Unclassified 1295
95 JGI24702J35022_10063960 3300002462 Bacteria 1972
96 JGI24705J35276_12236969 3300002504 Bacteria 9452
97 Ga0063521_1000269 3300003973 Bacteria 33899
98 Ga0466734_172774 3300042623 Bacteria 2002
99 Ga0466735_088475 3300042624 Bacteria 1307
100 Ga0466735_218912 3300042624 Bacteria 8347
101 Ga0466703_098882 3300042636 Bacteria 1533
102 Ga0466704_035267 3300042643 Bacteria 25525
103 Ga0466704_036919 3300042643 Bacteria 9740
104 Ga0466727_103610 3300042655 Bacteria 3622
105 Ga0466727_227440 3300042655 Bacteria 5978
106 Ga0466707_019093 3300042601 Bacteria 28365
107 Ga0466722_243136 3300042609 Bacteria 2473
108 Ga0466657_012937 3300042582 Bacteria 1450
109 Ga0466711_105587 3300042615 Bacteria 5617
110 Ga0466715_369198 3300042616 Bacteria 3016
111 Ga0466723_313427 3300042618 Bacteria 3061
112 Ga0466728_044205 3300042620 Bacteria 6721
113 Ga0123355_10423522 3300009826 Bacteria 1699
114 Ga0123353_10081634 3300010167 Bacteria 5199
115 Ga0160466_101144 3300012809 Bacteria 8439
116 JGI24702J35022_10061731 3300002462 Bacteria 2006
117 JGI24705J35276_12212713 3300002504 Bacteria 1898
118 Ga0074188_1000270 3300005318 Bacteria 11461
119 Ga0466705_238366 3300042612 Bacteria 4601
120 Ga0466704_277628 3300042643 Bacteria 15785
121 Ga0466708_318343 3300042652 Bacteria 5312
122 Ga0466716_019774 3300042605 Bacteria 1249
123 Ga0466705_433282 3300042612 Bacteria 9105
124 Ga0466715_018745 3300042616 Bacteria 13317
125 Ga0466715_583154 3300042616 Bacteria 7583
126 Ga0466728_052673 3300042620 Bacteria 8527
127 Ga0123353_10186206 3300010167 Bacteria 3283
128 Ga0160442_104640 3300012806 Bacteria 1409
129 Ga0104049_1029104 3300007103 Unclassified 2052
130 Ga0466705_171974 3300042612 Bacteria 5134
131 Ga0466733_124128 3300042659 Bacteria 2305
132 Ga0466704_225517 3300042643 Bacteria 11952
133 Ga0466704_389411 3300042643 Bacteria 2113
134 Ga0466704_509800 3300042643 Bacteria 1335
135 Ga0466708_224778 3300042652 Bacteria 8866
136 Ga0466706_267020 3300042599 Bacteria 3340
137 Ga0264413_139080 3300024493 Bacteria 7010
138 Ga0466723_013226 3300042618 Bacteria 1588
139 Ga0466728_006870 3300042620 Bacteria 6682
140 Ga0123355_10058065 3300009826 Bacteria 6261
141 Ga0123353_10004775 3300010167 Bacteria 17577
142 Ga0123353_10020384 3300010167 Bacteria 9901
143 DPOL_contig14399 2035918003 Bacteria 76515
144 DPOL_contig16134 2035918003 Bacteria 12452
145 Ga0105005_1008880 3300007505 Bacteria 19421

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042598 Ga0466701_076813 Ga0466701_076813_322_1137 271
2 3300010167 Ga0123353_11026922 Ga0123353_110269221 279
3 3300010167 Ga0123353_10081634 Ga0123353_100816342 305
4 3300042612 Ga0466705_445601 Ga0466705_445601_4259_5176 305
5 3300042615 Ga0466711_080340 Ga0466711_080340_20621_21538 305
6 3300042620 Ga0466728_006870 Ga0466728_006870_2369_3286 305
7 3300042606 Ga0466719_121509 Ga0466719_121509_3851_4780 309
8 3300042612 Ga0466705_357061 Ga0466705_357061_3122_4051 309
9 3300042601 Ga0466707_183098 Ga0466707_183098_3847_4779 310
10 3300042616 Ga0466715_583154 Ga0466715_583154_5747_6697 310
11 3300005318 Ga0074188_1155342 Ga0074188_11553422 311
12 3300007103 Ga0104049_1029104 Ga0104049_10291042 311
13 3300042601 Ga0466707_040886 Ga0466707_040886_265_1200 311
14 iso_pr_bacteria 2820312173 2820312956 312
15 3300002504 JGI24705J35276_12236969 JGI24705J35276_122369695 313
16 3300042621 Ga0466729_136603 Ga0466729_136603_1133_2074 313
17 3300005201 Ga0072941_1055919 Ga0072941_10559192 314
18 3300042593 Ga0466691_037135 Ga0466691_037135_6005_6949 314
19 3300042612 Ga0466705_436802 Ga0466705_436802_226_1170 314
20 3300042618 Ga0466723_229569 Ga0466723_229569_104970_105914 314
21 3300042643 Ga0466704_599969 Ga0466704_599969_646_1590 314
22 3300005201 Ga0072941_1053289 Ga0072941_10532894 315
23 3300042605 Ga0466716_019774 Ga0466716_019774_162_1109 315
24 3300042636 Ga0466703_350882 Ga0466703_350882_18104_19051 315
25 iso_pr_bacteria 2820211246 2820211999 315
26 3300002504 JGI24705J35276_12212713 JGI24705J35276_122127132 316
27 3300010167 Ga0123353_10001138 Ga0123353_1000113821 316
28 3300042612 Ga0466705_338122 Ga0466705_338122_786_1736 316
29 iso_pr_bacteria 2556921669 2558281911 317
30 iso_pr_bacteria 2820223845 2820224047 317
31 3300010049 Ga0123356_10564788 Ga0123356_105647882 318
32 3300005083 Ga0068305_10032434 Ga0068305_100324347 319
33 3300007505 Ga0105005_1008880 Ga0105005_100888015 319
34 3300042600 Ga0466700_382545 Ga0466700_382545_244_1203 319
35 3300042609 Ga0466722_243136 Ga0466722_243136_1059_2018 319
36 3300042624 Ga0466735_088475 Ga0466735_088475_39_998 319
37 3300005083 Ga0068305_10139106 Ga0068305_101391062 320
38 3300042582 Ga0466657_012937 Ga0466657_012937_357_1319 320
39 3300042613 Ga0466710_227767 Ga0466710_227767_2047_3009 320
40 3300042613 Ga0466710_392314 Ga0466710_392314_690_1652 320
41 3300042619 Ga0466726_207182 Ga0466726_207182_1024_1986 320
42 3300042643 Ga0466704_277628 Ga0466704_277628_14414_15376 320
43 3300042659 Ga0466733_124128 Ga0466733_124128_1082_2044 320
44 3300042602 Ga0466713_088818 Ga0466713_088818_7283_8248 321
45 3300042619 Ga0466726_472030 Ga0466726_472030_812_1777 321
46 3300042655 Ga0466727_103610 Ga0466727_103610_1715_2680 321
47 3300042612 Ga0466705_433282 Ga0466705_433282_6942_7910 322
48 3300042612 Ga0466705_445934 Ga0466705_445934_5160_6128 322
49 3300042643 Ga0466704_509800 Ga0466704_509800_81_1049 322
50 3300042643 Ga0466704_564685 Ga0466704_564685_144_1112 322
51 3300042648 Ga0466709_350948 Ga0466709_350948_2012_2980 322
52 iso_pr_bacteria 2819998259 2819999175 322
53 iso_pr_bacteria 2820719201 2820721566 322
54 3300010167 Ga0123353_10108646 Ga0123353_101086462 323
55 3300042618 Ga0466723_112275 Ga0466723_112275_838_1809 323
56 3300042624 Ga0466735_171057 Ga0466735_171057_1977_2948 323
57 3300042643 Ga0466704_035267 Ga0466704_035267_16407_17378 323
58 3300042643 Ga0466704_225517 Ga0466704_225517_4148_5146 323
59 3300042652 Ga0466708_174695 Ga0466708_174695_2363_3334 323
60 3300042655 Ga0466727_220926 Ga0466727_220926_1902_2873 323
61 iso_pr_bacteria 2820209022 2820210374 323
62 3300009826 Ga0123355_10423522 Ga0123355_104235222 324
63 3300010167 Ga0123353_10343068 Ga0123353_103430682 324
64 3300042599 Ga0466706_267020 Ga0466706_267020_588_1562 324
65 3300042636 Ga0466703_090843 Ga0466703_090843_8750_9724 324
66 3300042652 Ga0466708_224778 Ga0466708_224778_226_1251 324
67 iso_pr_bacteria 2781125694 2781435661 324
68 3300042601 Ga0466707_242645 Ga0466707_242645_1253_2230 325
69 3300042616 Ga0466715_133461 Ga0466715_133461_15304_16281 325
70 3300042619 Ga0466726_174079 Ga0466726_174079_185_1162 325
71 3300042619 Ga0466726_282184 Ga0466726_282184_513_1490 325
72 3300042624 Ga0466735_218912 Ga0466735_218912_7036_8013 325
73 iso_pr_bacteria 2820344559 2820344861 325
74 3300012806 Ga0160442_104640 Ga0160442_1046402 326
75 3300042615 Ga0466711_477203 Ga0466711_477203_3289_4269 326
76 3300042616 Ga0466715_115792 Ga0466715_115792_1679_2659 326
77 3300042652 Ga0466708_166272 Ga0466708_166272_693_1673 326
78 3300042655 Ga0466727_018589 Ga0466727_018589_2562_3542 326
79 3300042655 Ga0466727_256350 Ga0466727_256350_179_1159 326
80 iso_pr_bacteria 3004010258 3004012437 326
81 iso_pr_bacteria 8021535516 8021536206 326
82 iso_pr_bacteria 8021540981 8021542671 326
83 3300009826 Ga0123355_10554887 Ga0123355_105548872 327
84 3300042615 Ga0466711_105587 Ga0466711_105587_3786_4769 327
85 3300042616 Ga0466715_115286 Ga0466715_115286_198_1181 327
86 3300042636 Ga0466703_098882 Ga0466703_098882_538_1521 327
87 3300042652 Ga0466708_212877 Ga0466708_212877_39778_40761 327
88 2035918003 DPOL_contig16134 DPOLB_846900 328
89 3300002462 JGI24702J35022_10063960 JGI24702J35022_100639602 328
90 3300042605 Ga0466716_001642 Ga0466716_001642_4571_5557 328
91 3300042615 Ga0466711_284014 Ga0466711_284014_13275_14261 328
92 3300042616 Ga0466715_071976 Ga0466715_071976_5918_6904 328
93 3300042616 Ga0466715_592399 Ga0466715_592399_1904_2890 328
94 3300042618 Ga0466723_075373 Ga0466723_075373_11276_12262 328
95 3300042636 Ga0466703_396491 Ga0466703_396491_233_1219 328
96 3300042648 Ga0466709_219168 Ga0466709_219168_4253_5239 328
97 3300042649 Ga0466724_60676 Ga0466724_60676_4887_5873 328
98 3300042652 Ga0466708_127935 Ga0466708_127935_28469_29455 328
99 iso_pr_bacteria 2820014844 2820016054 328
100 iso_pr_bacteria 2820451402 2820451623 328
101 iso_pr_bacteria 2847708326 2847711517 328
102 iso_pr_bacteria 2874434233 2874435829 328
103 iso_pr_bacteria 2874504452 2874504586 328
104 iso_pr_bacteria 2878947168 2878948688 328
105 iso_pr_bacteria 2922113941 2922116424 328
106 iso_pr_bacteria 2937735258 2937738742 328
107 iso_pr_bacteria 2937751072 2937753109 328
108 iso_pr_bacteria 2961232173 2961234315 328
109 iso_pr_bacteria 2965197371 2965201284 328
110 iso_pr_bacteria 2970791725 2970795338 328
111 iso_pr_bacteria 2978161719 2978162442 328
112 iso_pr_bacteria 2996406003 2996409255 328
113 iso_pr_bacteria 2996467878 2996472812 328
114 iso_pr_bacteria 8004285568 8004288412 328
115 iso_pr_bacteria 8004307473 8004310333 328
116 iso_pr_bacteria 8004541719 8004542238 328
117 iso_pr_bacteria 8004571736 8004571894 328
118 iso_pr_bacteria 8004582426 8004584515 328
119 3300010167 Ga0123353_10004775 Ga0123353_100047754 329
120 3300010167 Ga0123353_10176735 Ga0123353_101767353 329
121 3300010167 Ga0123353_10186206 Ga0123353_101862064 329
122 3300010882 Ga0123354_10356716 Ga0123354_103567162 329
123 3300042612 Ga0466705_238366 Ga0466705_238366_387_1376 329
124 3300042618 Ga0466723_325522 Ga0466723_325522_574_1563 329
125 3300042621 Ga0466729_168296 Ga0466729_168296_4423_5628 329
126 3300042623 Ga0466734_172774 Ga0466734_172774_153_1142 329
127 3300042625 Ga0466730_051123 Ga0466730_051123_117_1154 329
128 iso_pr_bacteria 2781125688 2781422836 329
129 3300010882 Ga0123354_10031700 Ga0123354_100317006 330
130 3300024582 Ga0265387_1000090 Ga0265387_100009018 330
131 3300042601 Ga0466707_019093 Ga0466707_019093_14716_15708 330
132 3300042592 Ga0466693_052064 Ga0466693_052064_1493_2488 331
133 3300042619 Ga0466726_127382 Ga0466726_127382_293_1288 331
134 3300042655 Ga0466727_227440 Ga0466727_227440_1107_2102 331
135 3300042652 Ga0466708_318343 Ga0466708_318343_240_1238 332
136 3300010167 Ga0123353_10283878 Ga0123353_102838783 333
137 3300042619 Ga0466726_408992 Ga0466726_408992_5317_6318 333
138 iso_pr_bacteria 2890957088 2890959679 333
139 2035918003 DPOL_contig14399 DPOLB_433450 334
140 3300005318 Ga0074188_1000227 Ga0074188_100022712 334
141 3300042593 Ga0466691_220219 Ga0466691_220219_2396_3400 334
142 iso_pr_bacteria 2820267566 2820267939 334
143 3300003973 Ga0063521_1000269 Ga0063521_100026930 335
144 3300010167 Ga0123353_10099342 Ga0123353_100993424 335
145 3300042596 Ga0466696_283887 Ga0466696_283887_2704_3711 335
146 3300042596 Ga0466696_482005 Ga0466696_482005_1422_2429 335
147 3300042616 Ga0466715_018745 Ga0466715_018745_5777_6784 335
148 3300042618 Ga0466723_013226 Ga0466723_013226_42_1049 335
149 3300042620 Ga0466728_044205 Ga0466728_044205_5482_6489 335
150 3300005318 Ga0074188_1000270 Ga0074188_10002707 336
151 3300009826 Ga0123355_10000256 Ga0123355_100002564 336
152 3300012809 Ga0160466_101144 Ga0160466_1011447 336
153 3300042593 Ga0466691_196931 Ga0466691_196931_2712_3722 336
154 3300042612 Ga0466705_060583 Ga0466705_060583_2528_3538 336
155 3300042612 Ga0466705_171974 Ga0466705_171974_2149_3159 336
156 3300042612 Ga0466705_435943 Ga0466705_435943_1259_2269 336
157 3300042618 Ga0466723_313427 Ga0466723_313427_934_1944 336
158 3300042643 Ga0466704_389411 Ga0466704_389411_960_1970 336
159 3300042652 Ga0466708_337754 Ga0466708_337754_396_1406 336
160 3300009826 Ga0123355_10058065 Ga0123355_100580656 337
161 3300010167 Ga0123353_10020384 Ga0123353_100203843 337
162 3300024493 Ga0264413_139080 Ga0264413_1390803 337
163 3300010049 Ga0123356_10001750 Ga0123356_1000175010 338
164 3300042616 Ga0466715_369198 Ga0466715_369198_559_1575 338
165 iso_pr_bacteria 2515154104 2515590354 338
166 3300042615 Ga0466711_365712 Ga0466711_365712_8038_9057 339
167 3300042636 Ga0466703_144769 Ga0466703_144769_3997_5016 339
168 3300042643 Ga0466704_036919 Ga0466704_036919_3896_4918 340
169 3300042636 Ga0466703_276839 Ga0466703_276839_6780_7805 341
170 3300009826 Ga0123355_10446366 Ga0123355_104463662 342
171 3300009826 Ga0123355_10678160 Ga0123355_106781602 342
172 3300042618 Ga0466723_124748 Ga0466723_124748_5738_6769 343
173 3300042620 Ga0466728_052673 Ga0466728_052673_3307_4338 343
174 3300042648 Ga0466709_128248 Ga0466709_128248_1739_2770 343
175 3300042652 Ga0466708_036939 Ga0466708_036939_13567_14598 343
176 iso_pr_bacteria 2767802234 2769328927 344
177 iso_pr_bacteria 650716102 650881783 344
178 3300042619 Ga0466726_186879 Ga0466726_186879_12949_13995 348
179 3300012831 Ga0160459_101021 Ga0160459_1010216 349
180 3300012845 Ga0160460_100583 Ga0160460_10058318 349
181 3300002462 JGI24702J35022_10061731 JGI24702J35022_100617311 353
182 3300042616 Ga0466715_387864 Ga0466715_387864_2274_3338 354
183 3300042598 Ga0466701_073991 Ga0466701_073991_275_1417 380

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08352 oligo_HPY Oligopeptide/dipeptide transporter, C-terminal region 286 350 0.99
PF00005 ABC_tran ABC transporter 71 235 0.85

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.