Protein Family IF05492
Metagenome
Isolate
194
Members
62
Samples
188
Scaffolds
114.57
Avg Length
Representative Sequence
- ID
- 3300042598|Ga0466701_058567|Ga0466701_058567_628_1020
- Length
- 130 aa
- Sequence
- MVKASLKPNVPMQGDIIKINLDPKQGHEQKGYRPYICLSHHLVSDYANIAVFAPISNTSRQYPLYVPLKGTKSTGVVLLDQLVTIDYNARQWSYVETIDNDFLDELLEKTIVVFQNNNFGNNKPATPSMA
Sample Types
Isolate
3.1%
Metagenome
96.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.2%
Kalotermitidae
18.6%
Unclassified
11.9%
Rhinotermitidae
6.8%
Termopsidae
5.1%
Hodotermitidae
1.7%
Passalidae
1.7%
Taxonomy
Archaea
0
Bacteria
173
Eukaryota
0
Viruses
1
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 31 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 34 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 39 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 40 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 43 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 44 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 45 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 46 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 47 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 48 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 49 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 54 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 57 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 58 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 59 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 60 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 61 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 62 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_133740 | 3300042659 | Bacteria | 5392 |
| 2 | Ga0466703_198759 | 3300042636 | Bacteria | 2827 |
| 3 | Ga0466709_112104 | 3300042648 | Bacteria | 2656 |
| 4 | Ga0466727_299867 | 3300042655 | Bacteria | 1001 |
| 5 | Ga0123356_10187780 | 3300010049 | Bacteria | 2095 |
| 6 | Ga0123356_11638035 | 3300010049 | Unclassified | 797 |
| 7 | Ga0123354_10319363 | 3300010882 | Bacteria | 1436 |
| 8 | JGI24698J34947_10004364 | 3300002449 | Bacteria | 7693 |
| 9 | JGI24698J34947_10169663 | 3300002449 | Unclassified | 884 |
| 10 | JGI24695J34938_10023320 | 3300002450 | Bacteria | 2986 |
| 11 | JGI24702J35022_10050275 | 3300002462 | Bacteria | 2220 |
| 12 | Ga0072941_1067750 | 3300005201 | Bacteria | 3273 |
| 13 | Ga0466692_147542 | 3300042591 | Bacteria | 1085 |
| 14 | Ga0466691_184020 | 3300042593 | Bacteria | 5899 |
| 15 | Ga0466699_150151 | 3300042597 | Bacteria | 2725 |
| 16 | Ga0466712_259697 | 3300042614 | Bacteria | 1047 |
| 17 | Ga0466715_032470 | 3300042616 | Bacteria | 17892 |
| 18 | Ga0466715_072850 | 3300042616 | Bacteria | 10551 |
| 19 | Ga0466718_111423 | 3300042617 | Bacteria | 15265 |
| 20 | Ga0466718_152557 | 3300042617 | Unclassified | 1172 |
| 21 | Ga0466728_374972 | 3300042620 | Bacteria | 1157 |
| 22 | Ga0466701_058567 | 3300042598 | Bacteria | 1175 |
| 23 | Ga0466706_110976 | 3300042599 | Bacteria | 1223 |
| 24 | Ga0466706_204717 | 3300042599 | Bacteria | 1311 |
| 25 | Ga0466700_040533 | 3300042600 | Bacteria | 1066 |
| 26 | Ga0466707_055789 | 3300042601 | Bacteria | 1313 |
| 27 | Ga0466720_104074 | 3300042607 | Bacteria | 30495 |
| 28 | Ga0466698_041850 | 3300042610 | Bacteria | 1216 |
| 29 | Ga0466705_290748 | 3300042612 | Bacteria | 9050 |
| 30 | Ga0466733_131334 | 3300042659 | Bacteria | 1206 |
| 31 | Ga0466733_139925 | 3300042659 | Bacteria | 1253 |
| 32 | Ga0466727_186549 | 3300042655 | Bacteria | 2806 |
| 33 | Ga0466727_317550 | 3300042655 | Bacteria | 1118 |
| 34 | Ga0123355_10657263 | 3300009826 | Bacteria | 1221 |
| 35 | Ga0123353_10335981 | 3300010167 | Bacteria | 2284 |
| 36 | IMNBL1DRAFT_c0019390 | 3300000062 | Bacteria | 2788 |
| 37 | JGI24698J34947_10001813 | 3300002449 | Bacteria | 11398 |
| 38 | JGI24695J34938_10022890 | 3300002450 | Bacteria | 3022 |
| 39 | JGI24695J34938_10026152 | 3300002450 | Bacteria | 2777 |
| 40 | JGI24695J34938_10072189 | 3300002450 | Unclassified | 1441 |
| 41 | Ga0264413_129892 | 3300024493 | Bacteria | 1293 |
| 42 | Ga0415639_059340 | 3300038395 | Bacteria | 2545 |
| 43 | Ga0466690_239993 | 3300042590 | Unclassified | 1051 |
| 44 | Ga0466712_100038 | 3300042614 | Bacteria | 22106 |
| 45 | Ga0466715_295197 | 3300042616 | Unclassified | 2334 |
| 46 | Ga0466718_092541 | 3300042617 | Unclassified | 1411 |
| 47 | Ga0466718_146555 | 3300042617 | Unclassified | 3799 |
| 48 | Ga0466706_228086 | 3300042599 | Bacteria | 3018 |
| 49 | Ga0466707_087548 | 3300042601 | Bacteria | 1008 |
| 50 | Ga0466707_198809 | 3300042601 | Bacteria | 1219 |
| 51 | Ga0466707_245880 | 3300042601 | Bacteria | 4738 |
| 52 | Ga0466719_393325 | 3300042606 | Bacteria | 1325 |
| 53 | Ga0466720_010609 | 3300042607 | Bacteria | 20996 |
| 54 | Ga0466722_136356 | 3300042609 | Bacteria | 3143 |
| 55 | Ga0466698_470290 | 3300042610 | Bacteria | 1614 |
| 56 | Ga0123355_10166522 | 3300009826 | Bacteria | 3306 |
| 57 | Ga0123355_10303195 | 3300009826 | Viruses | 2175 |
| 58 | Ga0123355_10324579 | 3300009826 | Bacteria | 2070 |
| 59 | AustNasuHG_c1003569 | 3300000089 | Bacteria | 5618 |
| 60 | JGI24698J34947_10002307 | 3300002449 | Bacteria | 10249 |
| 61 | JGI24695J34938_10015879 | 3300002450 | Bacteria | 3849 |
| 62 | Ga0072941_1019204 | 3300005201 | Bacteria | 4046 |
| 63 | Ga0264413_100338 | 3300024493 | Unclassified | 2171 |
| 64 | Ga0466699_354773 | 3300042597 | Unclassified | 8544 |
| 65 | Ga0466712_105034 | 3300042614 | Bacteria | 39434 |
| 66 | Ga0466715_068985 | 3300042616 | Bacteria | 29330 |
| 67 | Ga0466718_028329 | 3300042617 | Bacteria | 1321 |
| 68 | Ga0466718_137442 | 3300042617 | Bacteria | 12053 |
| 69 | Ga0466726_317881 | 3300042619 | Bacteria | 3153 |
| 70 | Ga0466700_488054 | 3300042600 | Bacteria | 1280 |
| 71 | Ga0466707_020712 | 3300042601 | Bacteria | 1185 |
| 72 | Ga0466707_156981 | 3300042601 | Bacteria | 1169 |
| 73 | Ga0466707_377352 | 3300042601 | Bacteria | 1733 |
| 74 | Ga0466719_380840 | 3300042606 | Bacteria | 3082 |
| 75 | Ga0466720_007554 | 3300042607 | Bacteria | 3146 |
| 76 | Ga0466720_029638 | 3300042607 | Bacteria | 2652 |
| 77 | Ga0466698_149835 | 3300042610 | Unclassified | 4443 |
| 78 | Ga0466698_304574 | 3300042610 | Bacteria | 1591 |
| 79 | Ga0466705_194441 | 3300042612 | Bacteria | 3653 |
| 80 | Ga0466708_017553 | 3300042652 | Bacteria | 1066 |
| 81 | Ga0466727_164474 | 3300042655 | Bacteria | 5277 |
| 82 | Ga0123355_10627896 | 3300009826 | Bacteria | 1263 |
| 83 | Ga0123353_11330257 | 3300010167 | Bacteria | 930 |
| 84 | AustNasuHG_c1039959 | 3300000089 | Bacteria | 1156 |
| 85 | FAAS_10006056 | 3300001880 | Bacteria | 1108 |
| 86 | FAAS_10110632 | 3300001880 | Bacteria | 533 |
| 87 | JGI24702J35022_10020623 | 3300002462 | Bacteria | 3576 |
| 88 | Ga0074263_145201 | 3300005485 | Bacteria | 853 |
| 89 | Ga0415639_057093 | 3300038395 | Bacteria | 4226 |
| 90 | Ga0466718_003536 | 3300042617 | Bacteria | 5159 |
| 91 | Ga0466729_165169 | 3300042621 | Bacteria | 2313 |
| 92 | Ga0466714_024458 | 3300042603 | Bacteria | 1162 |
| 93 | Ga0466716_010259 | 3300042605 | Bacteria | 3037 |
| 94 | Ga0466720_192205 | 3300042607 | Bacteria | 27673 |
| 95 | Ga0466722_241479 | 3300042609 | Bacteria | 1208 |
| 96 | Ga0466698_502131 | 3300042610 | Bacteria | 1133 |
| 97 | Ga0466731_350529 | 3300042622 | Bacteria | 4851 |
| 98 | Ga0466725_363112 | 3300042654 | Bacteria | 4712 |
| 99 | Ga0466727_013274 | 3300042655 | Bacteria | 1971 |
| 100 | Ga0466727_340299 | 3300042655 | Bacteria | 1362 |
| 101 | Ga0123355_10099250 | 3300009826 | Bacteria | 4589 |
| 102 | Ga0123355_10149028 | 3300009826 | Bacteria | 3559 |
| 103 | Ga0123353_10178513 | 3300010167 | Bacteria | 3364 |
| 104 | 2230969593 | 2228664004 | Bacteria | 18897 |
| 105 | JGI24698J34947_10036920 | 3300002449 | Bacteria | 2541 |
| 106 | JGI24698J34947_10046937 | 3300002449 | Bacteria | 2195 |
| 107 | JGI24695J34938_10004540 | 3300002450 | Bacteria | 9054 |
| 108 | JGI24695J34938_10046156 | 3300002450 | Bacteria | 1929 |
| 109 | Ga0074263_104682 | 3300005485 | Bacteria | 1610 |
| 110 | Ga0466690_015831 | 3300042590 | Unclassified | 1476 |
| 111 | Ga0466699_201728 | 3300042597 | Bacteria | 1254 |
| 112 | Ga0466706_131065 | 3300042599 | Bacteria | 1853 |
| 113 | Ga0466706_156722 | 3300042599 | Bacteria | 3050 |
| 114 | Ga0466707_171429 | 3300042601 | Bacteria | 1143 |
| 115 | Ga0466707_352438 | 3300042601 | Bacteria | 1135 |
| 116 | Ga0466719_384735 | 3300042606 | Bacteria | 2722 |
| 117 | Ga0466721_032587 | 3300042608 | Bacteria | 1281 |
| 118 | Ga0466705_055819 | 3300042612 | Bacteria | 1076 |
| 119 | Ga0466727_338830 | 3300042655 | Bacteria | 2572 |
| 120 | Ga0123357_10405673 | 3300009784 | Bacteria | 1235 |
| 121 | Ga0123356_11286311 | 3300010049 | Bacteria | 895 |
| 122 | Ga0123356_12549906 | 3300010049 | Bacteria | 640 |
| 123 | AustNasuHG_c1049915 | 3300000089 | Bacteria | 905 |
| 124 | JGI24698J34947_10158692 | 3300002449 | Bacteria | 929 |
| 125 | JGI24698J34947_10160311 | 3300002449 | Bacteria | 922 |
| 126 | JGI24695J34938_10085315 | 3300002450 | Unclassified | 1301 |
| 127 | JGI24702J35022_10067407 | 3300002462 | Unclassified | 1922 |
| 128 | Ga0072940_1063877 | 3300005200 | Bacteria | 1851 |
| 129 | Ga0466699_203129 | 3300042597 | Bacteria | 1806 |
| 130 | Ga0466712_004889 | 3300042614 | Bacteria | 4183 |
| 131 | Ga0466700_472585 | 3300042600 | Bacteria | 1286 |
| 132 | Ga0466707_393976 | 3300042601 | Bacteria | 1114 |
| 133 | Ga0466713_146974 | 3300042602 | Bacteria | 1289 |
| 134 | Ga0466720_050894 | 3300042607 | Bacteria | 11486 |
| 135 | Ga0466705_387141 | 3300042612 | Bacteria | 1397 |
| 136 | Ga0466732_166996 | 3300042656 | Bacteria | 1148 |
| 137 | Ga0466733_044858 | 3300042659 | Bacteria | 1765 |
| 138 | Ga0466733_165097 | 3300042659 | Bacteria | 2983 |
| 139 | Ga0466703_154102 | 3300042636 | Bacteria | 30649 |
| 140 | Ga0466709_127291 | 3300042648 | Bacteria | 9150 |
| 141 | Ga0123355_10910692 | 3300009826 | Bacteria | 953 |
| 142 | Ga0123356_11412056 | 3300010049 | Unclassified | 856 |
| 143 | Ga0123353_10118399 | 3300010167 | Bacteria | 4260 |
| 144 | AustNasuHG_c1014819 | 3300000089 | Bacteria | 2641 |
| 145 | FAAS_10654612 | 3300001880 | Bacteria | 558 |
| 146 | JGI24698J34947_10000901 | 3300002449 | Bacteria | 15066 |
| 147 | JGI24698J34947_10088458 | 3300002449 | Bacteria | 1429 |
| 148 | JGI24695J34938_10004282 | 3300002450 | Bacteria | 9433 |
| 149 | JGI24695J34938_10004495 | 3300002450 | Bacteria | 9123 |
| 150 | Ga0264413_100341 | 3300024493 | Unclassified | 4383 |
| 151 | Ga0456237_0001169 | 3300041968 | Bacteria | 4149 |
| 152 | Ga0466694_357597 | 3300042594 | Bacteria | 1114 |
| 153 | Ga0466712_057573 | 3300042614 | Bacteria | 6371 |
| 154 | Ga0466712_068791 | 3300042614 | Bacteria | 2927 |
| 155 | Ga0466718_090089 | 3300042617 | Bacteria | 1434 |
| 156 | Ga0466718_158774 | 3300042617 | Bacteria | 3011 |
| 157 | Ga0466723_052216 | 3300042618 | Bacteria | 1102 |
| 158 | Ga0466726_097299 | 3300042619 | Bacteria | 1285 |
| 159 | Ga0466706_166607 | 3300042599 | Bacteria | 2507 |
| 160 | Ga0466714_079560 | 3300042603 | Bacteria | 3023 |
| 161 | Ga0466720_216586 | 3300042607 | Bacteria | 2773 |
| 162 | Ga0466698_320944 | 3300042610 | Bacteria | 1897 |
| 163 | Ga0466733_183067 | 3300042659 | Bacteria | 4445 |
| 164 | Ga0466734_141310 | 3300042623 | Bacteria | 1299 |
| 165 | Ga0466735_200137 | 3300042624 | Bacteria | 4295 |
| 166 | Ga0466727_216782 | 3300042655 | Bacteria | 1192 |
| 167 | Ga0123355_10001079 | 3300009826 | Bacteria | 37648 |
| 168 | Ga0123353_10242720 | 3300010167 | Bacteria | 2797 |
| 169 | Ga0123354_10032862 | 3300010882 | Bacteria | 8128 |
| 170 | AustNasuHG_c1001498 | 3300000089 | Bacteria | 8374 |
| 171 | AustNasuHG_c1038489 | 3300000089 | Bacteria | 1203 |
| 172 | JGI24695J34938_10432337 | 3300002450 | Bacteria | 592 |
| 173 | JGI24705J35276_12228533 | 3300002504 | Bacteria | 3203 |
| 174 | JGI24699J35502_10343096 | 3300002509 | Unclassified | 537 |
| 175 | JGI24696J40584_12954783 | 3300002834 | Bacteria | 2705 |
| 176 | Ga0264413_106902 | 3300024493 | Bacteria | 3613 |
| 177 | Ga0264413_117099 | 3300024493 | Unclassified | 6263 |
| 178 | Ga0466693_332400 | 3300042592 | Bacteria | 40906 |
| 179 | Ga0466691_177111 | 3300042593 | Bacteria | 3204 |
| 180 | Ga0466694_132229 | 3300042594 | Bacteria | 15761 |
| 181 | Ga0466723_234981 | 3300042618 | Bacteria | 4315 |
| 182 | Ga0466707_319404 | 3300042601 | Bacteria | 2020 |
| 183 | Ga0466720_059172 | 3300042607 | Unclassified | 4729 |
| 184 | Ga0466720_094561 | 3300042607 | Bacteria | 5680 |
| 185 | Ga0466720_217906 | 3300042607 | Bacteria | 1439 |
| 186 | Ga0466721_347566 | 3300042608 | Bacteria | 1000 |
| 187 | Ga0466721_386483 | 3300042608 | Bacteria | 1103 |
| 188 | Ga0466698_302135 | 3300042610 | Unclassified | 1277 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002509 | JGI24699J35502_10343096 | JGI24699J35502_103430962 | 104 |
| 2 | 3300042614 | Ga0466712_259697 | Ga0466712_259697_447_794 | 105 |
| 3 | 3300001880 | FAAS_10110632 | FAAS_101106321 | 106 |
| 4 | 3300042597 | Ga0466699_203129 | Ga0466699_203129_1022_1345 | 107 |
| 5 | 3300042614 | Ga0466712_004889 | Ga0466712_004889_1685_2008 | 107 |
| 6 | 3300000089 | AustNasuHG_c1049915 | AustNasuHG_10499153 | 108 |
| 7 | 3300002449 | JGI24698J34947_10169663 | JGI24698J34947_101696632 | 108 |
| 8 | 3300005485 | Ga0074263_145201 | Ga0074263_1452011 | 108 |
| 9 | 3300042600 | Ga0466700_488054 | Ga0466700_488054_141_494 | 108 |
| 10 | 3300042609 | Ga0466722_241479 | Ga0466722_241479_682_1008 | 108 |
| 11 | 3300042610 | Ga0466698_302135 | Ga0466698_302135_435_761 | 108 |
| 12 | 3300042614 | Ga0466712_105034 | Ga0466712_105034_31887_32213 | 108 |
| 13 | 3300002449 | JGI24698J34947_10158692 | JGI24698J34947_101586922 | 109 |
| 14 | 3300042594 | Ga0466694_132229 | Ga0466694_132229_15387_15716 | 109 |
| 15 | 3300042599 | Ga0466706_204717 | Ga0466706_204717_545_874 | 109 |
| 16 | 3300042602 | Ga0466713_146974 | Ga0466713_146974_489_818 | 109 |
| 17 | 3300042608 | Ga0466721_032587 | Ga0466721_032587_447_776 | 109 |
| 18 | 3300042619 | Ga0466726_097299 | Ga0466726_097299_942_1271 | 109 |
| 19 | 3300009826 | Ga0123355_10166522 | Ga0123355_101665223 | 110 |
| 20 | 3300002462 | JGI24702J35022_10020623 | JGI24702J35022_100206232 | 111 |
| 21 | 3300002462 | JGI24702J35022_10067407 | JGI24702J35022_100674072 | 111 |
| 22 | 3300042600 | Ga0466700_472585 | Ga0466700_472585_897_1232 | 111 |
| 23 | 3300042607 | Ga0466720_104074 | Ga0466720_104074_28349_28684 | 111 |
| 24 | 3300002450 | JGI24695J34938_10072189 | JGI24695J34938_100721892 | 112 |
| 25 | 3300024493 | Ga0264413_100341 | Ga0264413_1003411 | 112 |
| 26 | 3300042597 | Ga0466699_201728 | Ga0466699_201728_810_1148 | 112 |
| 27 | 3300042597 | Ga0466699_354773 | Ga0466699_354773_365_703 | 112 |
| 28 | 3300042600 | Ga0466700_040533 | Ga0466700_040533_312_650 | 112 |
| 29 | 3300042603 | Ga0466714_024458 | Ga0466714_024458_434_772 | 112 |
| 30 | 3300042608 | Ga0466721_386483 | Ga0466721_386483_402_740 | 112 |
| 31 | 3300042612 | Ga0466705_290748 | Ga0466705_290748_565_903 | 112 |
| 32 | 3300009826 | Ga0123355_10324579 | Ga0123355_103245792 | 113 |
| 33 | 3300009826 | Ga0123355_10657263 | Ga0123355_106572632 | 113 |
| 34 | 3300009826 | Ga0123355_10910692 | Ga0123355_109106923 | 113 |
| 35 | 3300010049 | Ga0123356_11286311 | Ga0123356_112863112 | 113 |
| 36 | 3300042590 | Ga0466690_015831 | Ga0466690_015831_75_416 | 113 |
| 37 | 3300042593 | Ga0466691_184020 | Ga0466691_184020_396_737 | 113 |
| 38 | 3300042594 | Ga0466694_357597 | Ga0466694_357597_657_998 | 113 |
| 39 | 3300042599 | Ga0466706_156722 | Ga0466706_156722_1716_2057 | 113 |
| 40 | 3300042601 | Ga0466707_055789 | Ga0466707_055789_933_1274 | 113 |
| 41 | 3300042601 | Ga0466707_198809 | Ga0466707_198809_391_732 | 113 |
| 42 | 3300042601 | Ga0466707_393976 | Ga0466707_393976_117_458 | 113 |
| 43 | 3300042607 | Ga0466720_059172 | Ga0466720_059172_2787_3128 | 113 |
| 44 | 3300042607 | Ga0466720_192205 | Ga0466720_192205_17025_17366 | 113 |
| 45 | 3300042610 | Ga0466698_041850 | Ga0466698_041850_430_771 | 113 |
| 46 | 3300042610 | Ga0466698_149835 | Ga0466698_149835_3905_4246 | 113 |
| 47 | 3300042612 | Ga0466705_055819 | Ga0466705_055819_218_559 | 113 |
| 48 | 3300042612 | Ga0466705_194441 | Ga0466705_194441_2968_3309 | 113 |
| 49 | 3300042614 | Ga0466712_068791 | Ga0466712_068791_957_1298 | 113 |
| 50 | 3300042614 | Ga0466712_100038 | Ga0466712_100038_7216_7557 | 113 |
| 51 | 3300042616 | Ga0466715_295197 | Ga0466715_295197_1106_1447 | 113 |
| 52 | 3300042617 | Ga0466718_158774 | Ga0466718_158774_976_1317 | 113 |
| 53 | 3300042618 | Ga0466723_052216 | Ga0466723_052216_533_874 | 113 |
| 54 | 3300042622 | Ga0466731_350529 | Ga0466731_350529_186_527 | 113 |
| 55 | 3300042655 | Ga0466727_164474 | Ga0466727_164474_2828_3169 | 113 |
| 56 | 3300042659 | Ga0466733_044858 | Ga0466733_044858_1188_1529 | 113 |
| 57 | 3300042659 | Ga0466733_131334 | Ga0466733_131334_523_864 | 113 |
| 58 | 3300042659 | Ga0466733_133740 | Ga0466733_133740_2714_3055 | 113 |
| 59 | 3300042659 | Ga0466733_139925 | Ga0466733_139925_342_683 | 113 |
| 60 | 3300042659 | Ga0466733_165097 | Ga0466733_165097_235_576 | 113 |
| 61 | 2228664004 | 2230969593 | 2230682763 | 114 |
| 62 | 3300000089 | AustNasuHG_c1014819 | AustNasuHG_10148195 | 114 |
| 63 | 3300001880 | FAAS_10006056 | FAAS_100060562 | 114 |
| 64 | 3300002449 | JGI24698J34947_10046937 | JGI24698J34947_100469374 | 114 |
| 65 | 3300002449 | JGI24698J34947_10088458 | JGI24698J34947_100884582 | 114 |
| 66 | 3300002450 | JGI24695J34938_10026152 | JGI24695J34938_100261522 | 114 |
| 67 | 3300005201 | Ga0072941_1019204 | Ga0072941_10192047 | 114 |
| 68 | 3300009784 | Ga0123357_10405673 | Ga0123357_104056732 | 114 |
| 69 | 3300009826 | Ga0123355_10149028 | Ga0123355_101490282 | 114 |
| 70 | 3300010049 | Ga0123356_12549906 | Ga0123356_125499061 | 114 |
| 71 | 3300010167 | Ga0123353_11330257 | Ga0123353_113302572 | 114 |
| 72 | 3300010882 | Ga0123354_10319363 | Ga0123354_103193632 | 114 |
| 73 | 3300024493 | Ga0264413_106902 | Ga0264413_1069026 | 114 |
| 74 | 3300024493 | Ga0264413_117099 | Ga0264413_1170998 | 114 |
| 75 | 3300042590 | Ga0466690_239993 | Ga0466690_239993_235_579 | 114 |
| 76 | 3300042591 | Ga0466692_147542 | Ga0466692_147542_200_544 | 114 |
| 77 | 3300042593 | Ga0466691_177111 | Ga0466691_177111_1925_2269 | 114 |
| 78 | 3300042601 | Ga0466707_171429 | Ga0466707_171429_135_479 | 114 |
| 79 | 3300042601 | Ga0466707_319404 | Ga0466707_319404_835_1179 | 114 |
| 80 | 3300042605 | Ga0466716_010259 | Ga0466716_010259_275_619 | 114 |
| 81 | 3300042606 | Ga0466719_380840 | Ga0466719_380840_2606_2950 | 114 |
| 82 | 3300042606 | Ga0466719_384735 | Ga0466719_384735_1511_1855 | 114 |
| 83 | 3300042606 | Ga0466719_393325 | Ga0466719_393325_626_970 | 114 |
| 84 | 3300042607 | Ga0466720_010609 | Ga0466720_010609_18691_19035 | 114 |
| 85 | 3300042607 | Ga0466720_094561 | Ga0466720_094561_1555_1899 | 114 |
| 86 | 3300042607 | Ga0466720_216586 | Ga0466720_216586_1969_2313 | 114 |
| 87 | 3300042607 | Ga0466720_217906 | Ga0466720_217906_155_499 | 114 |
| 88 | 3300042610 | Ga0466698_304574 | Ga0466698_304574_832_1176 | 114 |
| 89 | 3300042610 | Ga0466698_320944 | Ga0466698_320944_1264_1608 | 114 |
| 90 | 3300042610 | Ga0466698_470290 | Ga0466698_470290_855_1199 | 114 |
| 91 | 3300042612 | Ga0466705_387141 | Ga0466705_387141_167_511 | 114 |
| 92 | 3300042614 | Ga0466712_057573 | Ga0466712_057573_2934_3278 | 114 |
| 93 | 3300042616 | Ga0466715_072850 | Ga0466715_072850_1788_2132 | 114 |
| 94 | 3300042617 | Ga0466718_003536 | Ga0466718_003536_4217_4561 | 114 |
| 95 | 3300042617 | Ga0466718_090089 | Ga0466718_090089_862_1206 | 114 |
| 96 | 3300042617 | Ga0466718_092541 | Ga0466718_092541_395_739 | 114 |
| 97 | 3300042617 | Ga0466718_111423 | Ga0466718_111423_168_512 | 114 |
| 98 | 3300042617 | Ga0466718_146555 | Ga0466718_146555_117_461 | 114 |
| 99 | 3300042617 | Ga0466718_152557 | Ga0466718_152557_151_495 | 114 |
| 100 | 3300042618 | Ga0466723_234981 | Ga0466723_234981_982_1326 | 114 |
| 101 | 3300042619 | Ga0466726_317881 | Ga0466726_317881_419_763 | 114 |
| 102 | 3300042621 | Ga0466729_165169 | Ga0466729_165169_1710_2054 | 114 |
| 103 | 3300042648 | Ga0466709_112104 | Ga0466709_112104_1978_2322 | 114 |
| 104 | 3300042648 | Ga0466709_127291 | Ga0466709_127291_6151_6495 | 114 |
| 105 | 3300042652 | Ga0466708_017553 | Ga0466708_017553_192_536 | 114 |
| 106 | 3300042655 | Ga0466727_013274 | Ga0466727_013274_470_814 | 114 |
| 107 | 3300042655 | Ga0466727_216782 | Ga0466727_216782_797_1141 | 114 |
| 108 | 3300042656 | Ga0466732_166996 | Ga0466732_166996_91_435 | 114 |
| 109 | iso_pr_bacteria | 2820587002 | 2820589787 | 114 |
| 110 | iso_pr_bacteria | 2820637417 | 2820638311 | 114 |
| 111 | iso_pr_bacteria | 650716102 | 650883266 | 114 |
| 112 | 3300000089 | AustNasuHG_c1001498 | AustNasuHG_10014985 | 115 |
| 113 | 3300000089 | AustNasuHG_c1038489 | AustNasuHG_10384893 | 115 |
| 114 | 3300002449 | JGI24698J34947_10000901 | JGI24698J34947_100009016 | 115 |
| 115 | 3300002449 | JGI24698J34947_10001813 | JGI24698J34947_1000181310 | 115 |
| 116 | 3300002449 | JGI24698J34947_10002307 | JGI24698J34947_1000230710 | 115 |
| 117 | 3300002449 | JGI24698J34947_10004364 | JGI24698J34947_1000436410 | 115 |
| 118 | 3300002449 | JGI24698J34947_10036920 | JGI24698J34947_100369205 | 115 |
| 119 | 3300002449 | JGI24698J34947_10160311 | JGI24698J34947_101603112 | 115 |
| 120 | 3300002450 | JGI24695J34938_10023320 | JGI24695J34938_100233202 | 115 |
| 121 | 3300002462 | JGI24702J35022_10050275 | JGI24702J35022_100502752 | 115 |
| 122 | 3300005201 | Ga0072941_1067750 | Ga0072941_10677502 | 115 |
| 123 | 3300005485 | Ga0074263_104682 | Ga0074263_1046822 | 115 |
| 124 | 3300009826 | Ga0123355_10001079 | Ga0123355_1000107933 | 115 |
| 125 | 3300009826 | Ga0123355_10303195 | Ga0123355_103031953 | 115 |
| 126 | 3300010049 | Ga0123356_10187780 | Ga0123356_101877803 | 115 |
| 127 | 3300010049 | Ga0123356_11412056 | Ga0123356_114120562 | 115 |
| 128 | 3300010167 | Ga0123353_10178513 | Ga0123353_101785133 | 115 |
| 129 | 3300010167 | Ga0123353_10242720 | Ga0123353_102427203 | 115 |
| 130 | 3300010167 | Ga0123353_10335981 | Ga0123353_103359813 | 115 |
| 131 | 3300010882 | Ga0123354_10032862 | Ga0123354_100328622 | 115 |
| 132 | 3300042597 | Ga0466699_150151 | Ga0466699_150151_637_984 | 115 |
| 133 | 3300042599 | Ga0466706_110976 | Ga0466706_110976_226_573 | 115 |
| 134 | 3300042603 | Ga0466714_079560 | Ga0466714_079560_2125_2472 | 115 |
| 135 | 3300042609 | Ga0466722_136356 | Ga0466722_136356_2260_2607 | 115 |
| 136 | 3300042636 | Ga0466703_154102 | Ga0466703_154102_26393_26740 | 115 |
| 137 | 3300042654 | Ga0466725_363112 | Ga0466725_363112_484_831 | 115 |
| 138 | 3300042655 | Ga0466727_340299 | Ga0466727_340299_874_1221 | 115 |
| 139 | iso_pr_bacteria | 2781125640 | 2781287656 | 115 |
| 140 | 3300000062 | IMNBL1DRAFT_c0019390 | IMNBL1DRAFT_00193902 | 116 |
| 141 | 3300000089 | AustNasuHG_c1039959 | AustNasuHG_10399594 | 116 |
| 142 | 3300002450 | JGI24695J34938_10022890 | JGI24695J34938_100228902 | 116 |
| 143 | 3300002450 | JGI24695J34938_10046156 | JGI24695J34938_100461562 | 116 |
| 144 | 3300009826 | Ga0123355_10627896 | Ga0123355_106278963 | 116 |
| 145 | 3300038395 | Ga0415639_057093 | Ga0415639_057093_42_392 | 116 |
| 146 | 3300038395 | Ga0415639_059340 | Ga0415639_059340_2113_2463 | 116 |
| 147 | 3300042601 | Ga0466707_087548 | Ga0466707_087548_197_547 | 116 |
| 148 | 3300042601 | Ga0466707_156981 | Ga0466707_156981_713_1063 | 116 |
| 149 | 3300042601 | Ga0466707_245880 | Ga0466707_245880_1075_1425 | 116 |
| 150 | 3300042601 | Ga0466707_377352 | Ga0466707_377352_140_490 | 116 |
| 151 | 3300042608 | Ga0466721_347566 | Ga0466721_347566_236_586 | 116 |
| 152 | 3300042610 | Ga0466698_502131 | Ga0466698_502131_365_715 | 116 |
| 153 | 3300042617 | Ga0466718_137442 | Ga0466718_137442_3887_4237 | 116 |
| 154 | 3300000089 | AustNasuHG_c1003569 | AustNasuHG_10035694 | 117 |
| 155 | 3300002504 | JGI24705J35276_12228533 | JGI24705J35276_122285336 | 117 |
| 156 | 3300005200 | Ga0072940_1063877 | Ga0072940_10638773 | 117 |
| 157 | 3300010049 | Ga0123356_11638035 | Ga0123356_116380352 | 117 |
| 158 | 3300010167 | Ga0123353_10118399 | Ga0123353_101183993 | 117 |
| 159 | 3300042592 | Ga0466693_332400 | Ga0466693_332400_7895_8248 | 117 |
| 160 | 3300042620 | Ga0466728_374972 | Ga0466728_374972_659_1012 | 117 |
| 161 | 3300042636 | Ga0466703_198759 | Ga0466703_198759_1567_1920 | 117 |
| 162 | 3300042655 | Ga0466727_186549 | Ga0466727_186549_2250_2603 | 117 |
| 163 | 3300042655 | Ga0466727_299867 | Ga0466727_299867_445_798 | 117 |
| 164 | 3300042655 | Ga0466727_317550 | Ga0466727_317550_510_863 | 117 |
| 165 | 3300042655 | Ga0466727_338830 | Ga0466727_338830_1998_2351 | 117 |
| 166 | iso_pr_bacteria | 2781125640 | 2781289312 | 117 |
| 167 | 3300002450 | JGI24695J34938_10004282 | JGI24695J34938_1000428210 | 118 |
| 168 | 3300002450 | JGI24695J34938_10004495 | JGI24695J34938_1000449512 | 118 |
| 169 | 3300002450 | JGI24695J34938_10004540 | JGI24695J34938_100045409 | 118 |
| 170 | 3300002450 | JGI24695J34938_10015879 | JGI24695J34938_100158794 | 118 |
| 171 | 3300002450 | JGI24695J34938_10085315 | JGI24695J34938_100853152 | 118 |
| 172 | 3300002834 | JGI24696J40584_12954783 | JGI24696J40584_129547837 | 118 |
| 173 | 3300009826 | Ga0123355_10099250 | Ga0123355_100992502 | 118 |
| 174 | 3300042607 | Ga0466720_029638 | Ga0466720_029638_1309_1665 | 118 |
| 175 | 3300042607 | Ga0466720_050894 | Ga0466720_050894_2142_2498 | 118 |
| 176 | 3300042616 | Ga0466715_068985 | Ga0466715_068985_28597_28953 | 118 |
| 177 | 3300042624 | Ga0466735_200137 | Ga0466735_200137_1173_1529 | 118 |
| 178 | 3300042659 | Ga0466733_183067 | Ga0466733_183067_1841_2197 | 118 |
| 179 | 3300002450 | JGI24695J34938_10432337 | JGI24695J34938_104323372 | 119 |
| 180 | 3300024493 | Ga0264413_129892 | Ga0264413_1298921 | 119 |
| 181 | 3300042599 | Ga0466706_131065 | Ga0466706_131065_1079_1438 | 119 |
| 182 | 3300042599 | Ga0466706_166607 | Ga0466706_166607_1136_1495 | 119 |
| 183 | 3300042599 | Ga0466706_228086 | Ga0466706_228086_771_1130 | 119 |
| 184 | 3300042607 | Ga0466720_007554 | Ga0466720_007554_523_882 | 119 |
| 185 | 3300042616 | Ga0466715_032470 | Ga0466715_032470_17237_17596 | 119 |
| 186 | 3300042623 | Ga0466734_141310 | Ga0466734_141310_70_429 | 119 |
| 187 | 3300024493 | Ga0264413_100338 | Ga0264413_1003384 | 120 |
| 188 | 3300041968 | Ga0456237_0001169 | Ga0456237_0001169_2238_2600 | 120 |
| 189 | 3300042601 | Ga0466707_352438 | Ga0466707_352438_51_416 | 121 |
| 190 | 3300042601 | Ga0466707_020712 | Ga0466707_020712_734_1102 | 122 |
| 191 | iso_pr_bacteria | 2820607737 | 2820607961 | 122 |
| 192 | 3300042617 | Ga0466718_028329 | Ga0466718_028329_137_526 | 129 |
| 193 | 3300042598 | Ga0466701_058567 | Ga0466701_058567_628_1020 | 130 |
| 194 | 3300001880 | FAAS_10654612 | FAAS_106546121 | 150 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02452 | PemK_toxin | PemK-like, MazF-like toxin of type II toxin-antitoxin system | 13 | 110 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02452 | GO:0003677 | DNA binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.76 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.