Protein Family IF05478
Metagenome
Isolate
159
Members
61
Samples
111
Scaffolds
99.24
Avg Length
Representative Sequence
- ID
- 3300042598|Ga0466701_049380|Ga0466701_049380_1048_1344
- Length
- 98 aa
- Sequence
- MENKLITKDHEKVKAFFLSLERMLDGIESLVENSKPSLNGERYLTDKEVSEKLKISRRTLQDYRTEGKIPYYQLGGKILYGESDIEKMLNDNYFPSFE
Sample Types
Isolate
30.2%
Metagenome
69.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.3%
Termitidae
28.3%
Kalotermitidae
23.3%
Passalidae
5.0%
Rhinotermitidae
3.3%
Unclassified
3.3%
Hydrophilidae
1.7%
Termopsidae
1.7%
Taxonomy
Archaea
0
Bacteria
142
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 2 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 13 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 14 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 15 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 16 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 17 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 18 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 19 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 20 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 21 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 22 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 26 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 29 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 30 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 31 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 36 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 37 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 38 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 39 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 40 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 41 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 48 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 49 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 50 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 51 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 52 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 53 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 54 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 55 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 56 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 57 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 58 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 59 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 60 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 61 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_049970 | 3300042659 | Bacteria | 2687 |
| 2 | Ga0466733_125949 | 3300042659 | Bacteria | 2104 |
| 3 | Ga0466698_224054 | 3300042610 | Bacteria | 3594 |
| 4 | Ga0466715_031743 | 3300042616 | Unclassified | 21590 |
| 5 | Ga0466703_095352 | 3300042636 | Bacteria | 2416 |
| 6 | Ga0466703_208333 | 3300042636 | Unclassified | 3322 |
| 7 | Ga0466704_119414 | 3300042643 | Bacteria | 3958 |
| 8 | Ga0466657_261779 | 3300042582 | Unclassified | 1099 |
| 9 | Ga0466691_170135 | 3300042593 | Bacteria | 15101 |
| 10 | Ga0466696_142626 | 3300042596 | Bacteria | 24818 |
| 11 | 2227530954 | 2225789004 | Unclassified | 633 |
| 12 | JGI24699J35502_10910672 | 3300002509 | Bacteria | 1070 |
| 13 | Ga0466733_050073 | 3300042659 | Bacteria | 6723 |
| 14 | Ga0466733_108022 | 3300042659 | Bacteria | 1417 |
| 15 | Ga0466733_116706 | 3300042659 | Bacteria | 13019 |
| 16 | Ga0466701_049380 | 3300042598 | Bacteria | 4269 |
| 17 | Ga0466701_071598 | 3300042598 | Bacteria | 1960 |
| 18 | Ga0466716_548657 | 3300042605 | Bacteria | 1840 |
| 19 | Ga0466723_221006 | 3300042618 | Bacteria | 3665 |
| 20 | Ga0466728_330280 | 3300042620 | Bacteria | 1121 |
| 21 | Ga0466703_362903 | 3300042636 | Bacteria | 1639 |
| 22 | Ga0466704_413095 | 3300042643 | Bacteria | 4291 |
| 23 | Ga0466704_532952 | 3300042643 | Bacteria | 2147 |
| 24 | Ga0466724_27900 | 3300042649 | Bacteria | 1173 |
| 25 | Ga0466708_134768 | 3300042652 | Bacteria | 1568 |
| 26 | Ga0466692_073969 | 3300042591 | Bacteria | 1995 |
| 27 | Ga0466696_226565 | 3300042596 | Bacteria | 1274 |
| 28 | Ga0123354_10286380 | 3300010882 | Bacteria | 1589 |
| 29 | 2227545189 | 2225789004 | Bacteria | 2932 |
| 30 | IMNBL1DRAFT_c0031594 | 3300000062 | Bacteria | 1923 |
| 31 | Ga0466716_416921 | 3300042605 | Bacteria | 4014 |
| 32 | Ga0466715_163341 | 3300042616 | Unclassified | 2872 |
| 33 | Ga0466728_171019 | 3300042620 | Bacteria | 1668 |
| 34 | Ga0466734_149220 | 3300042623 | Bacteria | 3509 |
| 35 | Ga0466703_090079 | 3300042636 | Unclassified | 17920 |
| 36 | Ga0466703_394441 | 3300042636 | Bacteria | 3109 |
| 37 | Ga0466709_005524 | 3300042648 | Bacteria | 140810 |
| 38 | Ga0265387_1013087 | 3300024582 | Bacteria | 1155 |
| 39 | Ga0265387_1018324 | 3300024582 | Bacteria | 1024 |
| 40 | Ga0466657_131347 | 3300042582 | Unclassified | 2695 |
| 41 | Ga0466696_150803 | 3300042596 | Unclassified | 4187 |
| 42 | 2227030664 | 2225789003 | Bacteria | 930 |
| 43 | 2227450244 | 2225789004 | Unclassified | 5429 |
| 44 | IMNBL1DRAFT_c0004453 | 3300000062 | Unclassified | 8429 |
| 45 | IMNBL1DRAFT_c0011064 | 3300000062 | Bacteria | 4247 |
| 46 | Ga0466697_188497 | 3300042611 | Bacteria | 1324 |
| 47 | Ga0466705_085883 | 3300042612 | Unclassified | 2063 |
| 48 | Ga0466733_219603 | 3300042659 | Bacteria | 1204 |
| 49 | Ga0466701_025685 | 3300042598 | Bacteria | 7309 |
| 50 | Ga0466719_323713 | 3300042606 | Bacteria | 5755 |
| 51 | Ga0466715_207342 | 3300042616 | Bacteria | 1665 |
| 52 | Ga0466703_416535 | 3300042636 | Bacteria | 5040 |
| 53 | Ga0265387_1101555 | 3300024582 | Bacteria | 599 |
| 54 | Ga0123357_10484264 | 3300009784 | Bacteria | 1042 |
| 55 | Ga0123356_12453041 | 3300010049 | Bacteria | 653 |
| 56 | IMNBL1DRAFT_c0004785 | 3300000062 | Bacteria | 7994 |
| 57 | IMNBL1DRAFT_c0017945 | 3300000062 | Bacteria | 2956 |
| 58 | Ga0466705_320118 | 3300042612 | Bacteria | 3090 |
| 59 | Ga0466733_023694 | 3300042659 | Bacteria | 1192 |
| 60 | Ga0466733_083509 | 3300042659 | Bacteria | 14519 |
| 61 | Ga0466733_107351 | 3300042659 | Bacteria | 4224 |
| 62 | Ga0466733_112696 | 3300042659 | Bacteria | 2151 |
| 63 | Ga0466711_349890 | 3300042615 | Unclassified | 1099 |
| 64 | Ga0466715_322798 | 3300042616 | Bacteria | 7099 |
| 65 | Ga0466723_357944 | 3300042618 | Bacteria | 26993 |
| 66 | Ga0466728_384906 | 3300042620 | Bacteria | 3640 |
| 67 | Ga0466729_309455 | 3300042621 | Bacteria | 2540 |
| 68 | Ga0466735_018544 | 3300042624 | Bacteria | 18756 |
| 69 | Ga0466690_400346 | 3300042590 | Bacteria | 4194 |
| 70 | Ga0466696_341479 | 3300042596 | Bacteria | 4787 |
| 71 | IMNBL1DRAFT_c0035815 | 3300000062 | Unclassified | 1743 |
| 72 | Ga0466701_081682 | 3300042598 | Bacteria | 16673 |
| 73 | Ga0466700_414214 | 3300042600 | Bacteria | 5643 |
| 74 | Ga0466716_358628 | 3300042605 | Bacteria | 15708 |
| 75 | Ga0466715_314187 | 3300042616 | Bacteria | 7233 |
| 76 | Ga0466729_137575 | 3300042621 | Bacteria | 2606 |
| 77 | Ga0265387_1012065 | 3300024582 | Bacteria | 1195 |
| 78 | Ga0466693_003357 | 3300042592 | Bacteria | 1857 |
| 79 | Ga0123356_10670085 | 3300010049 | Unclassified | 1205 |
| 80 | Ga0123353_10372845 | 3300010167 | Bacteria | 2139 |
| 81 | 2227542975 | 2225789004 | Unclassified | 2962 |
| 82 | IMNBL1DRAFT_c0002652 | 3300000062 | Bacteria | 12249 |
| 83 | JGI24702J35022_10804562 | 3300002462 | Unclassified | 586 |
| 84 | JGI24702J35022_10859417 | 3300002462 | Bacteria | 565 |
| 85 | Ga0466705_068748 | 3300042612 | Bacteria | 1433 |
| 86 | Ga0466701_030104 | 3300042598 | Bacteria | 25566 |
| 87 | Ga0466713_044193 | 3300042602 | Bacteria | 13984 |
| 88 | Ga0466713_094444 | 3300042602 | Bacteria | 37314 |
| 89 | Ga0466703_192075 | 3300042636 | Bacteria | 1071 |
| 90 | Ga0466704_334370 | 3300042643 | Bacteria | 5013 |
| 91 | Ga0466696_329662 | 3300042596 | Bacteria | 5969 |
| 92 | Ga0123357_10139153 | 3300009784 | Bacteria | 2991 |
| 93 | Ga0123356_12817578 | 3300010049 | Bacteria | 608 |
| 94 | Ga0123353_10829305 | 3300010167 | Bacteria | 1272 |
| 95 | 2227494383 | 2225789004 | Bacteria | 3982 |
| 96 | JGI24705J35276_12235254 | 3300002504 | Bacteria | 6339 |
| 97 | Ga0466733_139401 | 3300042659 | Bacteria | 2446 |
| 98 | Ga0466733_194259 | 3300042659 | Bacteria | 1372 |
| 99 | Ga0466701_066362 | 3300042598 | Bacteria | 1157 |
| 100 | Ga0466714_062548 | 3300042603 | Bacteria | 5860 |
| 101 | Ga0466719_208784 | 3300042606 | Bacteria | 2495 |
| 102 | Ga0466734_100608 | 3300042623 | Bacteria | 1555 |
| 103 | Ga0466657_049563 | 3300042582 | Bacteria | 3401 |
| 104 | Ga0466691_118510 | 3300042593 | Bacteria | 5641 |
| 105 | Ga0466691_134727 | 3300042593 | Bacteria | 19404 |
| 106 | Ga0466691_200209 | 3300042593 | Bacteria | 7675 |
| 107 | Ga0466696_254734 | 3300042596 | Bacteria | 6163 |
| 108 | Ga0466701_007282 | 3300042598 | Bacteria | 1734 |
| 109 | Ga0123356_13857900 | 3300010049 | Bacteria | 517 |
| 110 | Ga0123354_10010251 | 3300010882 | Unclassified | 14429 |
| 111 | IMNBL1DRAFT_c0008600 | 3300000062 | Bacteria | 5175 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002462 | JGI24702J35022_10804562 | JGI24702J35022_108045622 | 93 |
| 2 | 2225789004 | 2227530954 | 2228043058 | 96 |
| 3 | 3300042596 | Ga0466696_226565 | Ga0466696_226565_164_457 | 97 |
| 4 | 3300042616 | Ga0466715_163341 | Ga0466715_163341_1245_1538 | 97 |
| 5 | 3300042616 | Ga0466715_322798 | Ga0466715_322798_3845_4138 | 97 |
| 6 | 3300042582 | Ga0466657_049563 | Ga0466657_049563_3054_3350 | 98 |
| 7 | 3300042582 | Ga0466657_131347 | Ga0466657_131347_731_1027 | 98 |
| 8 | 3300042582 | Ga0466657_261779 | Ga0466657_261779_752_1048 | 98 |
| 9 | 3300042593 | Ga0466691_118510 | Ga0466691_118510_3758_4054 | 98 |
| 10 | 3300042593 | Ga0466691_134727 | Ga0466691_134727_11889_12185 | 98 |
| 11 | 3300042593 | Ga0466691_170135 | Ga0466691_170135_1598_1894 | 98 |
| 12 | 3300042596 | Ga0466696_254734 | Ga0466696_254734_4931_5227 | 98 |
| 13 | 3300042596 | Ga0466696_341479 | Ga0466696_341479_1717_2013 | 98 |
| 14 | 3300042598 | Ga0466701_030104 | Ga0466701_030104_24441_24737 | 98 |
| 15 | 3300042598 | Ga0466701_049380 | Ga0466701_049380_1048_1344 | 98 |
| 16 | 3300042600 | Ga0466700_414214 | Ga0466700_414214_5113_5409 | 98 |
| 17 | 3300042603 | Ga0466714_062548 | Ga0466714_062548_127_423 | 98 |
| 18 | 3300042611 | Ga0466697_188497 | Ga0466697_188497_727_1023 | 98 |
| 19 | 3300042612 | Ga0466705_068748 | Ga0466705_068748_183_479 | 98 |
| 20 | 3300042612 | Ga0466705_085883 | Ga0466705_085883_1391_1687 | 98 |
| 21 | 3300042623 | Ga0466734_100608 | Ga0466734_100608_621_917 | 98 |
| 22 | 3300042623 | Ga0466734_149220 | Ga0466734_149220_323_619 | 98 |
| 23 | 3300042636 | Ga0466703_090079 | Ga0466703_090079_3816_4112 | 98 |
| 24 | 3300042636 | Ga0466703_095352 | Ga0466703_095352_285_581 | 98 |
| 25 | 3300042636 | Ga0466703_362903 | Ga0466703_362903_577_873 | 98 |
| 26 | 3300042636 | Ga0466703_394441 | Ga0466703_394441_845_1141 | 98 |
| 27 | 3300042636 | Ga0466703_416535 | Ga0466703_416535_3931_4227 | 98 |
| 28 | 3300042643 | Ga0466704_119414 | Ga0466704_119414_2229_2525 | 98 |
| 29 | 3300042643 | Ga0466704_413095 | Ga0466704_413095_3631_3927 | 98 |
| 30 | 3300042649 | Ga0466724_27900 | Ga0466724_27900_168_464 | 98 |
| 31 | 3300042659 | Ga0466733_023694 | Ga0466733_023694_379_675 | 98 |
| 32 | 3300042659 | Ga0466733_116706 | Ga0466733_116706_2163_2459 | 98 |
| 33 | iso_pr_bacteria | 2910926975 | 2910928478 | 98 |
| 34 | iso_pr_bacteria | 2910930387 | 2910932525 | 98 |
| 35 | iso_pr_bacteria | 2910942425 | 2910946244 | 98 |
| 36 | iso_pr_bacteria | 2910942425 | 2910947282 | 98 |
| 37 | iso_pr_bacteria | 2910959314 | 2910961336 | 98 |
| 38 | iso_pr_bacteria | 2910959314 | 2910962143 | 98 |
| 39 | iso_pr_bacteria | 2940202316 | 2940203249 | 98 |
| 40 | iso_pr_bacteria | 2940205530 | 2940208573 | 98 |
| 41 | iso_pr_bacteria | 2940205530 | 2940209002 | 98 |
| 42 | iso_pr_bacteria | 2940209341 | 2940209695 | 98 |
| 43 | iso_pr_bacteria | 2940212447 | 2940215487 | 98 |
| 44 | iso_pr_bacteria | 2940212447 | 2940215917 | 98 |
| 45 | iso_pr_bacteria | 2940298504 | 2940301541 | 98 |
| 46 | iso_pr_bacteria | 2940298504 | 2940301923 | 98 |
| 47 | iso_pr_bacteria | 2940302308 | 2940305343 | 98 |
| 48 | iso_pr_bacteria | 2940302308 | 2940305726 | 98 |
| 49 | iso_pr_bacteria | 2940306115 | 2940308861 | 98 |
| 50 | iso_pr_bacteria | 2940306115 | 2940309618 | 98 |
| 51 | iso_pr_bacteria | 2940309933 | 2940312699 | 98 |
| 52 | iso_pr_bacteria | 2940309933 | 2940313454 | 98 |
| 53 | iso_pr_bacteria | 2940313741 | 2940316512 | 98 |
| 54 | iso_pr_bacteria | 2940313741 | 2940317316 | 98 |
| 55 | iso_pr_bacteria | 2940317558 | 2940320327 | 98 |
| 56 | iso_pr_bacteria | 2940317558 | 2940321129 | 98 |
| 57 | iso_pr_bacteria | 2940321370 | 2940324083 | 98 |
| 58 | iso_pr_bacteria | 2940321370 | 2940324838 | 98 |
| 59 | iso_pr_bacteria | 2940325180 | 2940328213 | 98 |
| 60 | iso_pr_bacteria | 2940325180 | 2940328596 | 98 |
| 61 | iso_pr_bacteria | 2940328985 | 2940332020 | 98 |
| 62 | iso_pr_bacteria | 2940328985 | 2940332403 | 98 |
| 63 | iso_pr_bacteria | 2940332795 | 2940335457 | 98 |
| 64 | iso_pr_bacteria | 2940332795 | 2940336367 | 98 |
| 65 | 2225789003 | 2227030664 | 2227391656 | 99 |
| 66 | 2225789004 | 2227450244 | 2227887280 | 99 |
| 67 | 2225789004 | 2227494383 | 2227970216 | 99 |
| 68 | 2225789004 | 2227542975 | 2228066184 | 99 |
| 69 | 2225789004 | 2227545189 | 2228070190 | 99 |
| 70 | 3300024582 | Ga0265387_1012065 | Ga0265387_10120652 | 99 |
| 71 | 3300024582 | Ga0265387_1013087 | Ga0265387_10130872 | 99 |
| 72 | 3300024582 | Ga0265387_1018324 | Ga0265387_10183242 | 99 |
| 73 | 3300024582 | Ga0265387_1101555 | Ga0265387_11015551 | 99 |
| 74 | 3300042591 | Ga0466692_073969 | Ga0466692_073969_342_641 | 99 |
| 75 | 3300042592 | Ga0466693_003357 | Ga0466693_003357_1257_1556 | 99 |
| 76 | 3300042593 | Ga0466691_200209 | Ga0466691_200209_1707_2006 | 99 |
| 77 | 3300042596 | Ga0466696_150803 | Ga0466696_150803_829_1128 | 99 |
| 78 | 3300042596 | Ga0466696_329662 | Ga0466696_329662_3922_4221 | 99 |
| 79 | 3300042598 | Ga0466701_007282 | Ga0466701_007282_581_880 | 99 |
| 80 | 3300042598 | Ga0466701_025685 | Ga0466701_025685_4911_5210 | 99 |
| 81 | 3300042598 | Ga0466701_066362 | Ga0466701_066362_753_1052 | 99 |
| 82 | 3300042598 | Ga0466701_071598 | Ga0466701_071598_1488_1787 | 99 |
| 83 | 3300042598 | Ga0466701_081682 | Ga0466701_081682_15813_16112 | 99 |
| 84 | 3300042602 | Ga0466713_044193 | Ga0466713_044193_8443_8742 | 99 |
| 85 | 3300042605 | Ga0466716_358628 | Ga0466716_358628_4306_4605 | 99 |
| 86 | 3300042605 | Ga0466716_416921 | Ga0466716_416921_456_755 | 99 |
| 87 | 3300042606 | Ga0466719_208784 | Ga0466719_208784_12_311 | 99 |
| 88 | 3300042606 | Ga0466719_323713 | Ga0466719_323713_5409_5708 | 99 |
| 89 | 3300042612 | Ga0466705_320118 | Ga0466705_320118_1444_1743 | 99 |
| 90 | 3300042616 | Ga0466715_314187 | Ga0466715_314187_2879_3178 | 99 |
| 91 | 3300042618 | Ga0466723_221006 | Ga0466723_221006_2808_3107 | 99 |
| 92 | 3300042618 | Ga0466723_357944 | Ga0466723_357944_22557_22856 | 99 |
| 93 | 3300042620 | Ga0466728_171019 | Ga0466728_171019_258_557 | 99 |
| 94 | 3300042620 | Ga0466728_384906 | Ga0466728_384906_2396_2695 | 99 |
| 95 | 3300042621 | Ga0466729_137575 | Ga0466729_137575_1035_1334 | 99 |
| 96 | 3300042621 | Ga0466729_309455 | Ga0466729_309455_1589_1888 | 99 |
| 97 | 3300042636 | Ga0466703_208333 | Ga0466703_208333_1761_2060 | 99 |
| 98 | 3300042643 | Ga0466704_334370 | Ga0466704_334370_992_1291 | 99 |
| 99 | 3300042643 | Ga0466704_532952 | Ga0466704_532952_1199_1498 | 99 |
| 100 | 3300042648 | Ga0466709_005524 | Ga0466709_005524_84268_84567 | 99 |
| 101 | 3300042659 | Ga0466733_049970 | Ga0466733_049970_540_839 | 99 |
| 102 | 3300042659 | Ga0466733_050073 | Ga0466733_050073_2857_3156 | 99 |
| 103 | 3300042659 | Ga0466733_083509 | Ga0466733_083509_1030_1329 | 99 |
| 104 | 3300042659 | Ga0466733_107351 | Ga0466733_107351_2091_2390 | 99 |
| 105 | 3300042659 | Ga0466733_108022 | Ga0466733_108022_538_837 | 99 |
| 106 | 3300042659 | Ga0466733_125949 | Ga0466733_125949_1683_1982 | 99 |
| 107 | 3300042659 | Ga0466733_139401 | Ga0466733_139401_1661_1960 | 99 |
| 108 | 3300042659 | Ga0466733_194259 | Ga0466733_194259_434_733 | 99 |
| 109 | 3300042659 | Ga0466733_219603 | Ga0466733_219603_285_584 | 99 |
| 110 | iso_pr_bacteria | 2923982719 | 2923985145 | 99 |
| 111 | 3300000062 | IMNBL1DRAFT_c0002652 | IMNBL1DRAFT_000265211 | 100 |
| 112 | 3300000062 | IMNBL1DRAFT_c0004453 | IMNBL1DRAFT_00044534 | 100 |
| 113 | 3300000062 | IMNBL1DRAFT_c0004785 | IMNBL1DRAFT_00047856 | 100 |
| 114 | 3300000062 | IMNBL1DRAFT_c0008600 | IMNBL1DRAFT_00086006 | 100 |
| 115 | 3300000062 | IMNBL1DRAFT_c0011064 | IMNBL1DRAFT_00110643 | 100 |
| 116 | 3300000062 | IMNBL1DRAFT_c0017945 | IMNBL1DRAFT_00179454 | 100 |
| 117 | 3300000062 | IMNBL1DRAFT_c0031594 | IMNBL1DRAFT_00315944 | 100 |
| 118 | 3300000062 | IMNBL1DRAFT_c0035815 | IMNBL1DRAFT_00358151 | 100 |
| 119 | 3300002462 | JGI24702J35022_10859417 | JGI24702J35022_108594171 | 100 |
| 120 | 3300002504 | JGI24705J35276_12235254 | JGI24705J35276_122352544 | 100 |
| 121 | 3300002509 | JGI24699J35502_10910672 | JGI24699J35502_109106722 | 100 |
| 122 | 3300009784 | Ga0123357_10484264 | Ga0123357_104842641 | 100 |
| 123 | 3300010049 | Ga0123356_10670085 | Ga0123356_106700852 | 100 |
| 124 | 3300010049 | Ga0123356_12453041 | Ga0123356_124530412 | 100 |
| 125 | 3300010049 | Ga0123356_12817578 | Ga0123356_128175781 | 100 |
| 126 | 3300010167 | Ga0123353_10372845 | Ga0123353_103728454 | 100 |
| 127 | 3300010167 | Ga0123353_10829305 | Ga0123353_108293052 | 100 |
| 128 | 3300010882 | Ga0123354_10010251 | Ga0123354_100102514 | 100 |
| 129 | 3300010882 | Ga0123354_10286380 | Ga0123354_102863802 | 100 |
| 130 | 3300042590 | Ga0466690_400346 | Ga0466690_400346_3016_3318 | 100 |
| 131 | 3300042596 | Ga0466696_142626 | Ga0466696_142626_2291_2593 | 100 |
| 132 | 3300042602 | Ga0466713_094444 | Ga0466713_094444_4055_4357 | 100 |
| 133 | 3300042605 | Ga0466716_548657 | Ga0466716_548657_276_578 | 100 |
| 134 | 3300042615 | Ga0466711_349890 | Ga0466711_349890_199_501 | 100 |
| 135 | 3300042616 | Ga0466715_031743 | Ga0466715_031743_2772_3074 | 100 |
| 136 | 3300042624 | Ga0466735_018544 | Ga0466735_018544_12843_13145 | 100 |
| 137 | iso_pr_bacteria | 2695420314 | 2695472373 | 100 |
| 138 | iso_pr_bacteria | 2873600114 | 2873603773 | 100 |
| 139 | 3300042610 | Ga0466698_224054 | Ga0466698_224054_487_792 | 101 |
| 140 | 3300042659 | Ga0466733_112696 | Ga0466733_112696_36_341 | 101 |
| 141 | iso_pr_bacteria | 2920168565 | 2920169095 | 101 |
| 142 | iso_pr_bacteria | 2940202316 | 2940204012 | 101 |
| 143 | iso_pr_bacteria | 2940205530 | 2940208638 | 101 |
| 144 | iso_pr_bacteria | 2940212447 | 2940215552 | 101 |
| 145 | iso_pr_bacteria | 2940298504 | 2940301578 | 101 |
| 146 | iso_pr_bacteria | 2940302308 | 2940305408 | 101 |
| 147 | iso_pr_bacteria | 2940306115 | 2940308645 | 101 |
| 148 | iso_pr_bacteria | 2940309933 | 2940312483 | 101 |
| 149 | iso_pr_bacteria | 2940317558 | 2940320190 | 101 |
| 150 | iso_pr_bacteria | 2940321370 | 2940323945 | 101 |
| 151 | iso_pr_bacteria | 2940325180 | 2940328278 | 101 |
| 152 | iso_pr_bacteria | 2940328985 | 2940332057 | 101 |
| 153 | iso_pr_bacteria | 2940332795 | 2940335426 | 101 |
| 154 | 3300010049 | Ga0123356_13857900 | Ga0123356_138579001 | 102 |
| 155 | 3300042620 | Ga0466728_330280 | Ga0466728_330280_474_782 | 102 |
| 156 | 3300042636 | Ga0466703_192075 | Ga0466703_192075_214_534 | 106 |
| 157 | 3300042652 | Ga0466708_134768 | Ga0466708_134768_17_340 | 107 |
| 158 | 3300042616 | Ga0466715_207342 | Ga0466715_207342_411_755 | 114 |
| 159 | 3300009784 | Ga0123357_10139153 | Ga0123357_101391533 | 117 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12728 | HTH_17 | Helix-turn-helix domain | 43 | 92 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.52 | 0.69 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.