Protein Family IF05445

Metagenome Isolate
197 Members
79 Samples
170 Scaffolds
275.75 Avg Length

🧬 Representative Sequence

ID
3300042598|Ga0466701_024539|Ga0466701_024539_107374_108327
Length
298 aa
Sequence
MTKQELFENIKRKNTFLCVGLDTDIKKIPKHLLEEEDPIFAFNKAIIDATVDYCVAFKPNLAFYESLGTKGWISFEKTVQYLREYYPDQFLIADAKRGDIGNTSELYARAFFDEMKVDAVTVAPYMGSDSVKPFLYLMDEHKQYTIPRKGTWTILLALTSNEGADDFQLMFDGASDCHHKLYQKVLRKGKSWATDEQLMFVVGATQTGYLVEIRKIVPDYFLLIPGVGAQGGSLEEVCKYGMNSQCGLLVNNSRQIIYASNGKDFAEAAGQEAKKMQLEMEGLLIKYGRIQLCIANKA

📊 Sample Types

Isolate 13.7%
Metagenome 86.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 28.6%
Blattidae 19.5%
Kalotermitidae 16.9%
Unclassified 14.3%
Rhinotermitidae 5.2%
Termopsidae 3.9%
Passalidae 3.9%
Hydrophilidae 2.6%
Armadillidiidae 1.3%
Tenebrionidae 1.3%
Hodotermitidae 1.3%
Daphniidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 193
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
3 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
4 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
5 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
6 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
12 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
13 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
14 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 2922326829 Bacteroides sp. 224 Isolate Blattidae
17 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
18 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
19 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
20 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
23 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
24 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
25 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
28 3004677695 Bacteroides sp. 214 Isolate Blattidae
29 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
30 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
31 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
32 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
33 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
34 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
35 2923982719 Parabacteroides sp. 52 Isolate Blattidae
36 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
37 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
38 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
39 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
44 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
49 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
50 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
51 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
52 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
53 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
54 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
55 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
56 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
57 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
58 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
59 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
60 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
61 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
62 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
63 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
64 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
65 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
66 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
67 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
68 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
69 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
70 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
71 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
72 3004667792 Bacteroides sp. 519 Isolate Blattidae
73 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
74 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
75 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
76 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
77 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
78 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
79 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_089499 3300042611 Bacteria 34083
2 Ga0466733_121822 3300042659 Bacteria 48145
3 IMNBGM34_c006052 3300000036 Bacteria 1582
4 Ga0068305_10164107 3300005083 Bacteria 1044
5 Ga0466734_038665 3300042623 Bacteria 2752
6 Ga0466704_603730 3300042643 Bacteria 8988
7 Ga0466709_294395 3300042648 Bacteria 3435
8 Ga0466705_483013 3300042612 Bacteria 5437
9 Ga0466711_079520 3300042615 Bacteria 1641
10 Ga0466715_254235 3300042616 Bacteria 13922
11 Ga0466723_023862 3300042618 Bacteria 63714
12 Ga0466723_323008 3300042618 Bacteria 1254
13 Ga0466728_247329 3300042620 Bacteria 15985
14 Ga0123355_10000036 3300009826 Bacteria 135537
15 Ga0123356_10033300 3300010049 Bacteria 4819
16 Ga0123356_11149870 3300010049 Bacteria 943
17 Ga0123354_10308608 3300010882 Unclassified 1482
18 Ga0466716_418949 3300042605 Bacteria 41325
19 Ga0466698_142555 3300042610 Bacteria 1464
20 Ga0466690_033586 3300042590 Bacteria 3505
21 Ga0466696_193625 3300042596 Bacteria 10151
22 Ga0466696_271518 3300042596 Bacteria 4793
23 Ga0466701_012723 3300042598 Bacteria 34655
24 Ga0466705_259914 3300042612 Bacteria 3119
25 Ga0466733_030958 3300042659 Bacteria 11257
26 IMNBL1DRAFT_c0009126 3300000062 Bacteria 4949
27 JGI24702J35022_10026635 3300002462 Bacteria 3113
28 JGI24696J40584_12959790 3300002834 Bacteria 5649
29 Ga0466727_060642 3300042655 Bacteria 26590
30 Ga0466727_206812 3300042655 Bacteria 9489
31 Ga0466723_050959 3300042618 Bacteria 22300
32 Ga0466726_465351 3300042619 Bacteria 1609
33 Ga0123356_10122059 3300010049 Bacteria 2536
34 Ga0123353_10226880 3300010167 Bacteria 2915
35 Ga0123354_10161715 3300010882 Bacteria 2654
36 Ga0466700_466327 3300042600 Bacteria 6281
37 Ga0466707_306665 3300042601 Bacteria 13988
38 Ga0466713_085777 3300042602 Bacteria 19650
39 Ga0466722_051948 3300042609 Bacteria 11369
40 Ga0466690_219449 3300042590 Bacteria 8238
41 Ga0466691_148507 3300042593 Bacteria 9338
42 Ga0466694_284888 3300042594 Bacteria 1534
43 Ga0466696_458159 3300042596 Bacteria 1542
44 Ga0466733_190003 3300042659 Bacteria 2798
45 Ga0466733_209232 3300042659 Bacteria 28030
46 IMNBL1DRAFT_c0000047 3300000062 Bacteria 113822
47 Ga0068305_10031776 3300005083 Unclassified 5048
48 Ga0123357_10001051 3300009784 Bacteria 28363
49 Ga0466735_063520 3300042624 Bacteria 10049
50 Ga0466703_198609 3300042636 Bacteria 8838
51 Ga0466715_601574 3300042616 Bacteria 17986
52 Ga0466726_260216 3300042619 Bacteria 10848
53 Ga0123357_10005150 3300009784 Bacteria 15596
54 Ga0123355_10000009 3300009826 Bacteria 191038
55 Ga0123353_11047241 3300010167 Bacteria 1090
56 Ga0466713_008762 3300042602 Bacteria 34128
57 Ga0466713_036697 3300042602 Bacteria 37630
58 Ga0466713_097230 3300042602 Bacteria 35407
59 Ga0466714_162103 3300042603 Bacteria 35358
60 Ga0466716_069257 3300042605 Bacteria 11853
61 Ga0265387_1009171 3300024582 Bacteria 1335
62 Ga0466696_346787 3300042596 Bacteria 4022
63 JGI24699J35502_11134031 3300002509 Bacteria 25636
64 Ga0068305_10036704 3300005083 Bacteria 9267
65 Ga0072941_1082782 3300005201 Bacteria 2550
66 Ga0466729_223777 3300042621 Unclassified 7915
67 Ga0466703_149128 3300042636 Bacteria 1651
68 Ga0466704_059760 3300042643 Bacteria 7903
69 Ga0466709_220266 3300042648 Bacteria 4968
70 Ga0466727_271470 3300042655 Bacteria 12178
71 Ga0466710_013730 3300042613 Bacteria 5296
72 Ga0466723_265249 3300042618 Bacteria 1519
73 Ga0123357_10386034 3300009784 Bacteria 1293
74 Ga0123354_10530502 3300010882 Bacteria 899
75 Ga0466701_024539 3300042598 Bacteria 142878
76 Ga0466701_039977 3300042598 Bacteria 63641
77 Ga0466706_133816 3300042599 Bacteria 3105
78 Ga0466707_052075 3300042601 Bacteria 8190
79 Ga0466690_000575 3300042590 Bacteria 12614
80 Ga0466690_230745 3300042590 Bacteria 5334
81 Ga0466692_021260 3300042591 Bacteria 27216
82 Ga0466695_214883 3300042595 Bacteria 22622
83 IMNBGM34_c003071 3300000036 Bacteria 2342
84 IMNBL1DRAFT_c0004870 3300000062 Bacteria 7892
85 Ga0466709_419438 3300042648 Bacteria 66983
86 Ga0466708_050694 3300042652 Bacteria 2904
87 Ga0466711_398240 3300042615 Bacteria 5565
88 Ga0466715_434473 3300042616 Bacteria 7793
89 Ga0466728_021535 3300042620 Bacteria 23157
90 Ga0123357_10152730 3300009784 Bacteria 2796
91 Ga0123355_10319283 3300009826 Bacteria 2095
92 Ga0123354_10025535 3300010882 Bacteria 9315
93 Ga0123354_10458885 3300010882 Bacteria 1025
94 Ga0466707_017349 3300042601 Bacteria 1008
95 Ga0466707_067819 3300042601 Bacteria 13397
96 Ga0466714_034139 3300042603 Bacteria 66059
97 Ga0466690_002912 3300042590 Bacteria 1162
98 Ga0466696_059095 3300042596 Bacteria 32844
99 JGI24702J35022_10166964 3300002462 Bacteria 1243
100 JGI24699J35502_11134230 3300002509 Bacteria 99108
101 Ga0466734_009686 3300042623 Bacteria 2102
102 Ga0466735_223514 3300042624 Bacteria 1172
103 Ga0466709_164902 3300042648 Bacteria 31389
104 Ga0466708_070160 3300042652 Bacteria 39155
105 Ga0466711_025258 3300042615 Bacteria 45468
106 Ga0466726_173115 3300042619 Bacteria 1908
107 Ga0123356_10274261 3300010049 Bacteria 1778
108 Ga0123353_10001614 3300010167 Bacteria 27799
109 Ga0123353_10812514 3300010167 Bacteria 1289
110 Ga0123354_10016446 3300010882 Bacteria 11593
111 Ga0466706_160331 3300042599 Bacteria 28148
112 Ga0466707_355815 3300042601 Bacteria 1429
113 Ga0466713_051288 3300042602 Bacteria 230715
114 Ga0466714_010558 3300042603 Bacteria 1221
115 Ga0466656_312743 3300042550 Bacteria 3119
116 Ga0466657_205657 3300042582 Bacteria 10730
117 Ga0466690_160070 3300042590 Bacteria 10336
118 Ga0562377_0004 3300056842 Bacteria 3525959
119 2227555166 2225789004 Bacteria 14887
120 IMNBL1DRAFT_c0032351 3300000062 Bacteria 1888
121 JGI24702J35022_10013427 3300002462 Bacteria 4538
122 JGI24702J35022_10046456 3300002462 Bacteria 2312
123 JGI24702J35022_10077993 3300002462 Bacteria 1792
124 JGI24699J35502_11134232 3300002509 Bacteria 111679
125 Ga0466735_028285 3300042624 Bacteria 8603
126 Ga0466735_075577 3300042624 Bacteria 3915
127 Ga0466735_090879 3300042624 Bacteria 3152
128 Ga0466703_006491 3300042636 Bacteria 10874
129 Ga0466704_194858 3300042643 Bacteria 20469
130 Ga0466709_193399 3300042648 Bacteria 12327
131 Ga0466727_194241 3300042655 Bacteria 4306
132 Ga0466711_088766 3300042615 Bacteria 7157
133 Ga0466715_456224 3300042616 Bacteria 6820
134 Ga0466728_355270 3300042620 Bacteria 1179
135 Ga0123357_10415405 3300009784 Unclassified 1207
136 Ga0123354_10095295 3300010882 Bacteria 4074
137 Ga0466700_216390 3300042600 Bacteria 24849
138 Ga0466700_391565 3300042600 Bacteria 10641
139 Ga0466700_470872 3300042600 Bacteria 3532
140 Ga0466700_488783 3300042600 Bacteria 1525
141 Ga0466707_137104 3300042601 Bacteria 20593
142 Ga0466714_150935 3300042603 Bacteria 85449
143 Ga0466716_029364 3300042605 Bacteria 6213
144 Ga0466722_191438 3300042609 Bacteria 14939
145 Ga0466698_149631 3300042610 Bacteria 1171
146 Ga0466698_362079 3300042610 Bacteria 1334
147 Ga0160469_100004 3300012824 Bacteria 821419
148 Ga0466692_034223 3300042591 Bacteria 54843
149 Ga0466694_179533 3300042594 Bacteria 1577
150 Ga0466733_005503 3300042659 Bacteria 3314
151 Ga0466733_027595 3300042659 Bacteria 96004
152 Ga0466733_123823 3300042659 Bacteria 10632
153 IMNBL1DRAFT_c0033041 3300000062 Bacteria 1858
154 Ga0068305_10946871 3300005083 Bacteria 1476
155 Ga0072940_1453426 3300005200 Bacteria 1271
156 Ga0123357_10001874 3300009784 Bacteria 22834
157 Ga0466703_348714 3300042636 Bacteria 36764
158 Ga0466703_363700 3300042636 Bacteria 1952
159 Ga0466704_404397 3300042643 Bacteria 2014
160 Ga0466711_043781 3300042615 Bacteria 9352
161 Ga0466726_055053 3300042619 Bacteria 11347
162 Ga0466728_139106 3300042620 Bacteria 11729
163 Ga0466700_032177 3300042600 Bacteria 1050
164 Ga0466713_040181 3300042602 Bacteria 6215
165 Ga0466713_077466 3300042602 Bacteria 18852
166 Ga0466714_065131 3300042603 Bacteria 171349
167 Ga0466693_273242 3300042592 Bacteria 1565
168 Ga0466691_222074 3300042593 Bacteria 3328
169 Ga0466694_142791 3300042594 Bacteria 4455
170 Ga0466696_241627 3300042596 Bacteria 18100

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_075577 Ga0466735_075577_1293_2108 248
2 3300042618 Ga0466723_323008 Ga0466723_323008_454_1203 249
3 3300042610 Ga0466698_362079 Ga0466698_362079_324_1157 252
4 3300042593 Ga0466691_222074 Ga0466691_222074_646_1419 257
5 3300042659 Ga0466733_123823 Ga0466733_123823_4379_5155 258
6 3300042598 Ga0466701_012723 Ga0466701_012723_11005_11820 259
7 3300042624 Ga0466735_223514 Ga0466735_223514_378_1157 259
8 3300042590 Ga0466690_219449 Ga0466690_219449_2535_3377 260
9 3300042623 Ga0466734_038665 Ga0466734_038665_139_921 260
10 3300042601 Ga0466707_137104 Ga0466707_137104_163_990 264
11 3300000062 IMNBL1DRAFT_c0032351 IMNBL1DRAFT_00323512 266
12 3300010882 Ga0123354_10016446 Ga0123354_1001644610 267
13 3300042612 Ga0466705_259914 Ga0466705_259914_1493_2314 267
14 3300042591 Ga0466692_021260 Ga0466692_021260_12130_12942 270
15 3300042593 Ga0466691_148507 Ga0466691_148507_1473_2285 270
16 3300042609 Ga0466722_191438 Ga0466722_191438_1992_2804 270
17 3300042612 Ga0466705_483013 Ga0466705_483013_4472_5284 270
18 3300042643 Ga0466704_059760 Ga0466704_059760_6742_7554 270
19 3300042599 Ga0466706_133816 Ga0466706_133816_1471_2286 271
20 3300042643 Ga0466704_194858 Ga0466704_194858_6491_7306 271
21 3300042659 Ga0466733_190003 Ga0466733_190003_547_1362 271
22 3300002834 JGI24696J40584_12959790 JGI24696J40584_129597903 272
23 3300042596 Ga0466696_193625 Ga0466696_193625_2007_2840 272
24 3300042602 Ga0466713_085777 Ga0466713_085777_6329_7147 272
25 3300042603 Ga0466714_010558 Ga0466714_010558_243_1061 272
26 3300042603 Ga0466714_150935 Ga0466714_150935_27985_28803 272
27 iso_pr_bacteria 2820778767 2820780452 272
28 3300009784 Ga0123357_10005150 Ga0123357_100051507 273
29 3300010167 Ga0123353_10226880 Ga0123353_102268803 273
30 3300042591 Ga0466692_034223 Ga0466692_034223_8822_9643 273
31 3300042600 Ga0466700_032177 Ga0466700_032177_62_904 273
32 3300042601 Ga0466707_355815 Ga0466707_355815_321_1142 273
33 3300042616 Ga0466715_254235 Ga0466715_254235_3213_4034 273
34 3300042636 Ga0466703_348714 Ga0466703_348714_19669_20490 273
35 3300042659 Ga0466733_030958 Ga0466733_030958_5211_6032 273
36 iso_pr_bacteria 2910959314 2910961800 273
37 iso_pr_bacteria 3004677695 3004679130 273
38 3300000062 IMNBL1DRAFT_c0009126 IMNBL1DRAFT_00091261 274
39 3300010882 Ga0123354_10095295 Ga0123354_100952954 274
40 3300042582 Ga0466657_205657 Ga0466657_205657_423_1247 274
41 3300042590 Ga0466690_033586 Ga0466690_033586_963_1787 274
42 3300042601 Ga0466707_017349 Ga0466707_017349_97_921 274
43 3300042602 Ga0466713_008762 Ga0466713_008762_24699_25523 274
44 3300042602 Ga0466713_040181 Ga0466713_040181_2899_3723 274
45 3300042602 Ga0466713_051288 Ga0466713_051288_201465_202289 274
46 3300042610 Ga0466698_142555 Ga0466698_142555_598_1422 274
47 3300042611 Ga0466697_089499 Ga0466697_089499_3097_3921 274
48 3300042613 Ga0466710_013730 Ga0466710_013730_1533_2357 274
49 3300042615 Ga0466711_079520 Ga0466711_079520_451_1275 274
50 3300042616 Ga0466715_456224 Ga0466715_456224_538_1362 274
51 3300042616 Ga0466715_601574 Ga0466715_601574_12407_13231 274
52 3300042636 Ga0466703_006491 Ga0466703_006491_7025_7849 274
53 3300042636 Ga0466703_363700 Ga0466703_363700_579_1403 274
54 3300042643 Ga0466704_404397 Ga0466704_404397_133_957 274
55 3300042648 Ga0466709_419438 Ga0466709_419438_41018_41842 274
56 3300042659 Ga0466733_209232 Ga0466733_209232_27172_27996 274
57 3300056842 Ga0562377_0004 Ga0562377_0004_1427120_1427944 274
58 iso_pr_bacteria 2873600114 2873603518 274
59 iso_pr_bacteria 2873610414 2873613909 274
60 iso_pr_bacteria 2910930387 2910930972 274
61 iso_pr_bacteria 2910942425 2910943895 274
62 iso_pr_bacteria 2910949487 2910951715 274
63 iso_pr_bacteria 3004667792 3004668371 274
64 iso_pr_bacteria 8100166142 8100170758 274
65 3300005083 Ga0068305_10164107 Ga0068305_101641071 275
66 3300042590 Ga0466690_160070 Ga0466690_160070_142_969 275
67 3300042605 Ga0466716_029364 Ga0466716_029364_2749_3576 275
68 3300042615 Ga0466711_025258 Ga0466711_025258_23692_24519 275
69 3300042615 Ga0466711_398240 Ga0466711_398240_484_1311 275
70 3300042621 Ga0466729_223777 Ga0466729_223777_2048_2875 275
71 3300042655 Ga0466727_271470 Ga0466727_271470_8971_9798 275
72 3300042659 Ga0466733_027595 Ga0466733_027595_32972_33799 275
73 iso_pr_bacteria 2695420931 2698111173 275
74 3300000062 IMNBL1DRAFT_c0004870 IMNBL1DRAFT_00048707 276
75 3300005083 Ga0068305_10946871 Ga0068305_109468711 276
76 3300009826 Ga0123355_10000009 Ga0123355_10000009172 276
77 3300009826 Ga0123355_10319283 Ga0123355_103192833 276
78 3300024582 Ga0265387_1009171 Ga0265387_10091712 276
79 3300042596 Ga0466696_059095 Ga0466696_059095_19226_20056 276
80 3300042600 Ga0466700_488783 Ga0466700_488783_60_890 276
81 3300042601 Ga0466707_067819 Ga0466707_067819_3775_4605 276
82 3300042602 Ga0466713_097230 Ga0466713_097230_17429_18259 276
83 3300042609 Ga0466722_051948 Ga0466722_051948_4010_4840 276
84 3300042615 Ga0466711_043781 Ga0466711_043781_3100_3930 276
85 3300042616 Ga0466715_434473 Ga0466715_434473_557_1387 276
86 3300042618 Ga0466723_050959 Ga0466723_050959_5312_6142 276
87 3300042619 Ga0466726_055053 Ga0466726_055053_6856_7686 276
88 3300042619 Ga0466726_260216 Ga0466726_260216_6726_7556 276
89 3300042620 Ga0466728_247329 Ga0466728_247329_4533_5363 276
90 3300042624 Ga0466735_063520 Ga0466735_063520_6283_7113 276
91 3300042643 Ga0466704_603730 Ga0466704_603730_6519_7349 276
92 3300042659 Ga0466733_121822 Ga0466733_121822_32574_33404 276
93 iso_pr_bacteria 2590828803 2592927253 276
94 iso_pr_bacteria 2820788205 2820788279 276
95 3300000062 IMNBL1DRAFT_c0033041 IMNBL1DRAFT_00330412 277
96 3300002462 JGI24702J35022_10013427 JGI24702J35022_100134271 277
97 3300002462 JGI24702J35022_10077993 JGI24702J35022_100779931 277
98 3300005083 Ga0068305_10036704 Ga0068305_100367045 277
99 3300009826 Ga0123355_10000036 Ga0123355_1000003677 277
100 3300010049 Ga0123356_10122059 Ga0123356_101220592 277
101 3300012824 Ga0160469_100004 Ga0160469_100004528 277
102 3300042594 Ga0466694_142791 Ga0466694_142791_98_931 277
103 3300042594 Ga0466694_179533 Ga0466694_179533_536_1369 277
104 3300042594 Ga0466694_284888 Ga0466694_284888_587_1420 277
105 3300042596 Ga0466696_241627 Ga0466696_241627_3930_4763 277
106 3300042598 Ga0466701_039977 Ga0466701_039977_48105_48938 277
107 3300042599 Ga0466706_160331 Ga0466706_160331_21560_22393 277
108 3300042600 Ga0466700_216390 Ga0466700_216390_9881_10714 277
109 3300042601 Ga0466707_052075 Ga0466707_052075_2077_2910 277
110 3300042603 Ga0466714_034139 Ga0466714_034139_2828_3661 277
111 3300042610 Ga0466698_149631 Ga0466698_149631_279_1112 277
112 3300042618 Ga0466723_265249 Ga0466723_265249_361_1194 277
113 3300042619 Ga0466726_173115 Ga0466726_173115_286_1119 277
114 3300042620 Ga0466728_139106 Ga0466728_139106_2123_2956 277
115 3300042624 Ga0466735_028285 Ga0466735_028285_915_1748 277
116 3300042624 Ga0466735_090879 Ga0466735_090879_1585_2418 277
117 3300042648 Ga0466709_193399 Ga0466709_193399_2455_3288 277
118 3300042648 Ga0466709_294395 Ga0466709_294395_1710_2543 277
119 3300042655 Ga0466727_060642 Ga0466727_060642_4727_5560 277
120 3300042655 Ga0466727_194241 Ga0466727_194241_3057_3890 277
121 3300042655 Ga0466727_206812 Ga0466727_206812_7102_7935 277
122 iso_pr_bacteria 2820757377 2820759918 277
123 iso_pr_bacteria 2820759988 2820762718 277
124 iso_pr_bacteria 2940216256 2940216712 277
125 iso_pr_bacteria 2967483437 2967485025 277
126 3300000036 IMNBGM34_c003071 IMNBGM34_0030712 278
127 3300000036 IMNBGM34_c006052 IMNBGM34_0060522 278
128 3300000062 IMNBL1DRAFT_c0000047 IMNBL1DRAFT_000004788 278
129 3300002462 JGI24702J35022_10046456 JGI24702J35022_100464562 278
130 3300002462 JGI24702J35022_10166964 JGI24702J35022_101669641 278
131 3300002509 JGI24699J35502_11134031 JGI24699J35502_111340312 278
132 3300002509 JGI24699J35502_11134230 JGI24699J35502_111342309 278
133 3300002509 JGI24699J35502_11134232 JGI24699J35502_1113423279 278
134 3300005201 Ga0072941_1082782 Ga0072941_10827823 278
135 3300009784 Ga0123357_10001051 Ga0123357_1000105118 278
136 3300009784 Ga0123357_10001874 Ga0123357_1000187416 278
137 3300009784 Ga0123357_10152730 Ga0123357_101527302 278
138 3300009784 Ga0123357_10386034 Ga0123357_103860342 278
139 3300009784 Ga0123357_10415405 Ga0123357_104154052 278
140 3300010049 Ga0123356_10033300 Ga0123356_100333003 278
141 3300010049 Ga0123356_10274261 Ga0123356_102742612 278
142 3300010049 Ga0123356_11149870 Ga0123356_111498701 278
143 3300010167 Ga0123353_10812514 Ga0123353_108125142 278
144 3300010882 Ga0123354_10025535 Ga0123354_100255353 278
145 3300010882 Ga0123354_10308608 Ga0123354_103086082 278
146 3300010882 Ga0123354_10458885 Ga0123354_104588851 278
147 3300042596 Ga0466696_346787 Ga0466696_346787_202_1038 278
148 3300042602 Ga0466713_036697 Ga0466713_036697_20798_21634 278
149 3300042603 Ga0466714_162103 Ga0466714_162103_14522_15358 278
150 3300042620 Ga0466728_355270 Ga0466728_355270_263_1099 278
151 2225789004 2227555166 2228087617 279
152 3300042600 Ga0466700_391565 Ga0466700_391565_3906_4745 279
153 3300042600 Ga0466700_470872 Ga0466700_470872_2244_3083 279
154 3300042601 Ga0466707_306665 Ga0466707_306665_8598_9437 279
155 3300042619 Ga0466726_465351 Ga0466726_465351_178_1017 279
156 3300005200 Ga0072940_1453426 Ga0072940_14534261 280
157 3300010882 Ga0123354_10161715 Ga0123354_101617152 280
158 3300010882 Ga0123354_10530502 Ga0123354_105305021 280
159 3300042550 Ga0466656_312743 Ga0466656_312743_625_1467 280
160 3300042590 Ga0466690_000575 Ga0466690_000575_10574_11416 280
161 3300042590 Ga0466690_002912 Ga0466690_002912_190_1032 280
162 3300042590 Ga0466690_230745 Ga0466690_230745_185_1027 280
163 3300042595 Ga0466695_214883 Ga0466695_214883_10653_11495 280
164 3300042596 Ga0466696_271518 Ga0466696_271518_1942_2784 280
165 3300042596 Ga0466696_458159 Ga0466696_458159_654_1496 280
166 3300042600 Ga0466700_466327 Ga0466700_466327_3476_4318 280
167 3300042603 Ga0466714_065131 Ga0466714_065131_118414_119256 280
168 3300042605 Ga0466716_069257 Ga0466716_069257_8277_9119 280
169 3300042605 Ga0466716_418949 Ga0466716_418949_35359_36201 280
170 3300042615 Ga0466711_088766 Ga0466711_088766_3529_4371 280
171 3300042618 Ga0466723_023862 Ga0466723_023862_31969_32811 280
172 3300042620 Ga0466728_021535 Ga0466728_021535_12612_13454 280
173 3300042636 Ga0466703_198609 Ga0466703_198609_1100_1942 280
174 3300042648 Ga0466709_164902 Ga0466709_164902_5037_5879 280
175 3300042648 Ga0466709_220266 Ga0466709_220266_553_1395 280
176 3300042652 Ga0466708_050694 Ga0466708_050694_1292_2134 280
177 3300042652 Ga0466708_070160 Ga0466708_070160_24766_25608 280
178 iso_pr_bacteria 2820746860 2820747566 280
179 iso_pr_bacteria 2820770630 2820772092 280
180 iso_pr_bacteria 2923982719 2923982855 280
181 iso_pr_bacteria 2940195863 2940198230 280
182 iso_pr_bacteria 2940199050 2940199685 280
183 iso_pr_bacteria 2940209341 2940210330 280
184 iso_pr_bacteria 2940346213 2940346986 280
185 iso_pr_bacteria 2940371297 2940372940 280
186 3300010167 Ga0123353_10001614 Ga0123353_1000161420 281
187 3300042659 Ga0466733_005503 Ga0466733_005503_1231_2076 281
188 iso_pr_bacteria 2922326829 2922328194 281
189 iso_pr_bacteria 2940202316 2940204373 281
190 3300002462 JGI24702J35022_10026635 JGI24702J35022_100266352 283
191 3300010167 Ga0123353_11047241 Ga0123353_110472411 283
192 3300042602 Ga0466713_077466 Ga0466713_077466_1458_2309 283
193 3300005083 Ga0068305_10031776 Ga0068305_100317763 286
194 3300042636 Ga0466703_149128 Ga0466703_149128_127_987 286
195 3300042592 Ga0466693_273242 Ga0466693_273242_217_1092 291
196 3300042623 Ga0466734_009686 Ga0466734_009686_905_1798 297
197 3300042598 Ga0466701_024539 Ga0466701_024539_107374_108327 298

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family 17 267 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.