Protein Family IF05431

Metagenome Isolate
189 Members
71 Samples
142 Scaffolds
327.57 Avg Length

🧬 Representative Sequence

ID
3300042598|Ga0466701_019646|Ga0466701_019646_24617_25741
Length
374 aa
Sequence
MVQLVAQNETALYGLKRLPKVRSTPHPGAAFEMHNILETDSMPVPSLSPGLKAGLFAALVGVAAALPMAGAQAQPAYPSKPIRLVVPFPPGGGTDMIARTVAQKLADQNKWTVVVDNRPGAGGNLGVDAVAKAAPDGYTLVMGQTSNLAINPSLYARLPYDPLKNLAPVVLVSSAPIVMAAPANSPYKSFADVVAAAKANPDGITLGYSGNGTVAHLAGELAQKAAGIRLRHVPYKGAAQAMTDLVGGQIDLYMSAVPTLLGQVRNGKLRAVAITSLKRAEQLPQTPTLAESGYKDFEAASWFGVLAPAGTPAAVVARLNKAINDTLVEPDVIDKLRSEGGDVLGGSSEKFASLLRAEVPRWARIVKESGASLE

📊 Sample Types

Isolate 24.3%
Metagenome 75.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Formicidae 27.0%
Termitidae 20.6%
Culicidae 15.9%
Unclassified 9.5%
Armadillidiidae 6.3%
Elmidae 4.8%
Kalotermitidae 4.8%
Curculionidae 4.8%
Hydrophilidae 1.6%
Crambidae 1.6%
Alydidae 1.6%
Termopsidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 172
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820059968 Unclassified Proteobacteria Nt197P4bin23 Isolate Unclassified
2 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
3 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
4 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
5 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
6 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
7 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
8 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
11 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
12 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
13 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
17 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 8100455565 Delftia sp. S67 Isolate Curculionidae
21 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
22 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
23 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
24 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
25 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
26 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
27 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
28 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
29 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
30 8100449422 Delftia sp. S66 Isolate Curculionidae
31 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
32 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
33 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
34 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
35 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
36 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
37 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
38 2603880165 Burkholderiales A1 Isolate Unclassified
39 2603880170 Burkholderiales A2 Isolate Unclassified
40 2603880172 Burkholderiales C Isolate Unclassified
41 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
42 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
43 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
44 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
45 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
46 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
49 2868169047 Comamonas aquatica S00077 Isolate Elmidae
50 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
51 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
52 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
53 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
54 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
55 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
56 8100461708 Delftia sp. S65 Isolate Curculionidae
57 2864937364 Acidovorax soli S00198 Isolate Elmidae
58 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
59 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
60 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
61 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
62 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
63 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
64 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
65 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
66 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
67 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
68 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
69 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
70 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
71 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24705J35276_12235833 3300002504 Bacteria 7034
2 Ga0103266_1000006 3300007067 Bacteria 123352
3 Ga0102734_1003908 3300007129 Bacteria 3362
4 Ga0103268_1001482 3300007192 Bacteria 5801
5 Ga0466701_019646 3300042598 Bacteria 45844
6 Ga0466701_021535 3300042598 Bacteria 3172
7 Ga0466701_094535 3300042598 Bacteria 30246
8 Ga0466734_082709 3300042623 Bacteria 3355
9 Ga0466725_428176 3300042654 Bacteria 2758
10 Ga0123357_10356138 3300009784 Bacteria 1393
11 Ga0123354_10232556 3300010882 Bacteria 1922
12 Ga0160468_101029 3300012819 Bacteria 8176
13 Ga0160472_103754 3300012839 Bacteria 2881
14 Ga0160444_100176 3300012841 Bacteria 58928
15 Ga0160447_103545 3300012849 Bacteria 4946
16 Ga0466693_218003 3300042592 Bacteria 4632
17 CVPL010W_10004984 3300002931 Bacteria 14439
18 Ga0102736_1002894 3300007052 Bacteria 2615
19 Ga0103261_1001051 3300007083 Bacteria 5335
20 Ga0103260_1000491 3300007139 Unclassified 7564
21 Ga0102740_1000121 3300007140 Bacteria 20375
22 Ga0102740_1002596 3300007140 Bacteria 4085
23 Ga0102737_1000020 3300007142 Unclassified 47274
24 Ga0102737_1000129 3300007142 Bacteria 24069
25 Ga0102737_1001799 3300007142 Bacteria 5699
26 Ga0103264_1000171 3300007188 Bacteria 38057
27 Ga0103268_1000781 3300007192 Bacteria 8966
28 Ga0466701_055090 3300042598 Bacteria 8765
29 Ga0466701_086274 3300042598 Bacteria 54413
30 Ga0466717_159375 3300042604 Unclassified 5680
31 Ga0466730_035815 3300042625 Bacteria 115756
32 Ga0466730_084562 3300042625 Bacteria 141346
33 Ga0466725_057356 3300042654 Bacteria 2163
34 Ga0123357_10088536 3300009784 Bacteria 4045
35 Ga0160465_100595 3300012803 Bacteria 15343
36 Ga0160472_100160 3300012839 Bacteria 94418
37 Ga0160472_104057 3300012839 Bacteria 2685
38 Ga0466696_389774 3300042596 Bacteria 2441
39 Ga0466701_011131 3300042598 Bacteria 37031
40 CVPL010W_10000939 3300002931 Bacteria 61824
41 Ga0102739_1004441 3300007095 Bacteria 1978
42 Ga0102734_1022842 3300007129 Bacteria 1572
43 Ga0102740_1003935 3300007140 Bacteria 3051
44 Ga0466701_076976 3300042598 Bacteria 69062
45 Ga0466734_161294 3300042623 Bacteria 1855
46 Ga0466730_008052 3300042625 Bacteria 162273
47 Ga0466730_048836 3300042625 Bacteria 29351
48 Ga0466730_091823 3300042625 Bacteria 280166
49 Ga0160470_100462 3300012813 Bacteria 17574
50 Ga0160458_110656 3300012832 Bacteria 1024
51 Ga0160472_101040 3300012839 Bacteria 9777
52 Ga0160472_107782 3300012839 Bacteria 1485
53 Ga0160460_104242 3300012845 Bacteria 2259
54 Ga0160448_103320 3300012854 Bacteria 4747
55 Ga0466657_264143 3300042582 Bacteria 3681
56 Ga0466701_007577 3300042598 Bacteria 87791
57 CVPL010W_10001691 3300002931 Bacteria 28576
58 CVPL010W_10005673 3300002931 Unclassified 31736
59 CVPL005L_10010705 3300002938 Unclassified 7436
60 Ga0466701_039104 3300042598 Bacteria 68236
61 Ga0466713_036465 3300042602 Bacteria 1331
62 Ga0466717_146712 3300042604 Bacteria 3313
63 Ga0466730_012298 3300042625 Bacteria 263602
64 Ga0466724_29472 3300042649 Bacteria 417400
65 Ga0123354_10002077 3300010882 Bacteria 25862
66 Ga0123354_10031282 3300010882 Bacteria 8352
67 Ga0160465_100764 3300012803 Bacteria 12063
68 Ga0160466_102622 3300012809 Unclassified 3400
69 Ga0160432_100687 3300012818 Bacteria 17752
70 Ga0160468_100898 3300012819 Bacteria 9206
71 Ga0160467_100430 3300012829 Bacteria 42007
72 Ga0160460_102916 3300012845 Bacteria 3380
73 Ga0160447_103399 3300012849 Unclassified 5113
74 Ga0160447_110977 3300012849 Bacteria 1950
75 Ga0160430_112581 3300012852 Bacteria 1365
76 Ga0466657_331938 3300042582 Bacteria 4319
77 Ga0466710_056595 3300042613 Bacteria 5494
78 CVPL010W_10008080 3300002931 Unclassified 10078
79 CVPL005W_1001399 3300002934 Unclassified 6434
80 Ga0102735_1000040 3300007080 Bacteria 36563
81 Ga0466701_044499 3300042598 Bacteria 1815
82 Ga0466734_056962 3300042623 Bacteria 3088
83 Ga0466730_060188 3300042625 Bacteria 807184
84 Ga0466725_026202 3300042654 Bacteria 10948
85 Ga0466727_311191 3300042655 Bacteria 2280
86 Ga0160470_100774 3300012813 Unclassified 9938
87 Ga0160440_100093 3300012815 Bacteria 101451
88 Ga0160469_100459 3300012824 Bacteria 19126
89 Ga0160459_106125 3300012831 Bacteria 1543
90 Ga0160447_101135 3300012849 Bacteria 10692
91 Ga0160430_105039 3300012852 Bacteria 3114
92 CVPL010W_10022320 3300002931 Bacteria 6833
93 CVPL005W_1001365 3300002934 Unclassified 6544
94 CVPL005L_10019727 3300002938 Bacteria 3543
95 Ga0103265_1001729 3300007068 Bacteria 3486
96 Ga0103261_1001566 3300007083 Bacteria 3648
97 Ga0102739_1002380 3300007095 Bacteria 2907
98 Ga0102738_1001035 3300007141 Unclassified 4370
99 Ga0102737_1005457 3300007142 Bacteria 2533
100 Ga0103268_1000562 3300007192 Unclassified 11031
101 Ga0466701_081372 3300042598 Bacteria 123772
102 Ga0466734_136381 3300042623 Bacteria 2732
103 Ga0466734_149222 3300042623 Bacteria 1563
104 Ga0466730_007839 3300042625 Bacteria 149242
105 Ga0466704_490148 3300042643 Bacteria 2187
106 Ga0466708_111722 3300042652 Bacteria 4281
107 Ga0466725_238796 3300042654 Bacteria 3720
108 Ga0160453_101208 3300012814 Bacteria 10103
109 Ga0160459_100051 3300012831 Bacteria 180680
110 Ga0160472_100315 3300012839 Bacteria 48174
111 Ga0160436_1004383 3300012861 Unclassified 3367
112 Ga0466693_414356 3300042592 Bacteria 4478
113 Ga0466701_006461 3300042598 Unclassified 66758
114 JGI24705J35276_12234442 3300002504 Unclassified 5523
115 CVPL010W_10010626 3300002931 Bacteria 7931
116 Ga0103263_101611 3300007042 Unclassified 2877
117 Ga0103266_1000194 3300007067 Bacteria 17363
118 Ga0102740_1000423 3300007140 Bacteria 11759
119 Ga0103268_1000767 3300007192 Bacteria 13787
120 Ga0466701_035715 3300042598 Bacteria 24676
121 Ga0466730_030029 3300042625 Bacteria 423027
122 Ga0466724_24188 3300042649 Bacteria 438343
123 Ga0466708_449947 3300042652 Bacteria 7441
124 Ga0466725_184348 3300042654 Bacteria 14313
125 Ga0160446_100401 3300012835 Bacteria 21213
126 Ga0160430_100049 3300012852 Bacteria 131621
127 Ga0160435_1000866 3300012857 Bacteria 8338
128 Ga0466656_026916 3300042550 Bacteria 1496
129 Ga0102736_1004755 3300007052 Bacteria 3268
130 Ga0103266_1000260 3300007067 Bacteria 15994
131 Ga0103265_1002999 3300007068 Bacteria 2540
132 Ga0103261_1000279 3300007083 Bacteria 10189
133 Ga0102738_1001119 3300007141 Bacteria 4204
134 Ga0102737_1002859 3300007142 Bacteria 4121
135 Ga0466730_027569 3300042625 Bacteria 173946
136 Ga0466730_096842 3300042625 Bacteria 56272
137 Ga0160454_100559 3300012798 Bacteria 10051
138 Ga0160466_104040 3300012809 Bacteria 2223
139 Ga0160441_103673 3300012825 Bacteria 2587
140 Ga0160436_1001113 3300012861 Bacteria 7809
141 Ga0466657_257363 3300042582 Bacteria 1285
142 Ga0466693_007588 3300042592 Bacteria 2055

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_389774 Ga0466696_389774_1582_2430 282
2 3300042604 Ga0466717_159375 Ga0466717_159375_4465_5433 286
3 3300002504 JGI24705J35276_12234442 JGI24705J35276_122344421 287
4 3300042652 Ga0466708_111722 Ga0466708_111722_182_1171 290
5 3300042654 Ga0466725_184348 Ga0466725_184348_10938_11903 298
6 3300012803 Ga0160465_100595 Ga0160465_1005959 303
7 3300042654 Ga0466725_057356 Ga0466725_057356_48_1001 303
8 3300007142 Ga0102737_1001799 Ga0102737_10017994 304
9 3300012839 Ga0160472_104057 Ga0160472_1040572 305
10 3300042625 Ga0466730_091823 Ga0466730_091823_187166_188143 305
11 3300012832 Ga0160458_110656 Ga0160458_1106561 307
12 3300012839 Ga0160472_100160 Ga0160472_10016032 308
13 3300042625 Ga0466730_084562 Ga0466730_084562_73266_74243 308
14 3300012852 Ga0160430_100049 Ga0160430_10004951 309
15 3300042592 Ga0466693_218003 Ga0466693_218003_3237_4205 309
16 3300010882 Ga0123354_10002077 Ga0123354_1000207717 311
17 3300042592 Ga0466693_007588 Ga0466693_007588_430_1401 311
18 3300007140 Ga0102740_1000121 Ga0102740_10001218 313
19 3300012819 Ga0160468_101029 Ga0160468_10102910 313
20 3300012815 Ga0160440_100093 Ga0160440_10009372 314
21 3300012852 Ga0160430_112581 Ga0160430_1125811 314
22 3300007042 Ga0103263_101611 Ga0103263_1016112 315
23 3300002931 CVPL010W_10010626 CVPL010W_100106268 316
24 3300042625 Ga0466730_027569 Ga0466730_027569_159464_160468 316
25 3300007052 Ga0102736_1004755 Ga0102736_10047553 318
26 3300007192 Ga0103268_1001482 Ga0103268_10014825 318
27 3300042598 Ga0466701_006461 Ga0466701_006461_55333_56355 320
28 3300042625 Ga0466730_060188 Ga0466730_060188_375521_376543 320
29 iso_pr_bacteria 2864826666 2864827832 320
30 3300012798 Ga0160454_100559 Ga0160454_1005599 321
31 3300012849 Ga0160447_103399 Ga0160447_1033992 321
32 3300042598 Ga0466701_055090 Ga0466701_055090_633_1598 321
33 3300042604 Ga0466717_146712 Ga0466717_146712_2061_3026 321
34 iso_pr_bacteria 2603880170 2606029698 321
35 iso_pr_bacteria 2864937364 2864942427 321
36 3300002931 CVPL010W_10004984 CVPL010W_100049844 322
37 3300002931 CVPL010W_10008080 CVPL010W_100080805 322
38 3300002931 CVPL010W_10022320 CVPL010W_100223206 322
39 3300002934 CVPL005W_1001399 CVPL005W_10013992 322
40 3300002938 CVPL005L_10010705 CVPL005L_100107053 322
41 3300007083 Ga0103261_1001566 Ga0103261_10015662 322
42 3300007142 Ga0102737_1000129 Ga0102737_100012911 322
43 3300007142 Ga0102737_1005457 Ga0102737_10054572 322
44 3300012814 Ga0160453_101208 Ga0160453_1012085 322
45 3300042550 Ga0466656_026916 Ga0466656_026916_265_1233 322
46 3300042582 Ga0466657_264143 Ga0466657_264143_2440_3408 322
47 3300042613 Ga0466710_056595 Ga0466710_056595_1798_2766 322
48 iso_pr_bacteria 2603880165 2606014946 322
49 iso_pr_bacteria 2820059968 2820060709 322
50 iso_pr_bacteria 2864826666 2864827977 322
51 iso_pr_bacteria 2864826666 2864828817 322
52 iso_pr_bacteria 2873571580 2873574140 322
53 3300002504 JGI24705J35276_12235833 JGI24705J35276_122358334 323
54 3300007068 Ga0103265_1002999 Ga0103265_10029993 323
55 3300042582 Ga0466657_257363 Ga0466657_257363_45_1016 323
56 iso_pr_bacteria 2868169047 2868170670 323
57 3300012831 Ga0160459_106125 Ga0160459_1061252 324
58 3300012835 Ga0160446_100401 Ga0160446_1004019 324
59 3300012849 Ga0160447_110977 Ga0160447_1109772 324
60 3300012861 Ga0160436_1004383 Ga0160436_10043832 324
61 3300042598 Ga0466701_044499 Ga0466701_044499_210_1184 324
62 3300042623 Ga0466734_136381 Ga0466734_136381_1693_2667 324
63 3300042623 Ga0466734_161294 Ga0466734_161294_568_1542 324
64 3300042654 Ga0466725_026202 Ga0466725_026202_2260_3234 324
65 3300042654 Ga0466725_238796 Ga0466725_238796_1050_2024 324
66 iso_pr_bacteria 2864826666 2864829120 324
67 iso_pr_bacteria 2864937364 2864937536 324
68 3300007139 Ga0103260_1000491 Ga0103260_10004915 325
69 3300007141 Ga0102738_1001035 Ga0102738_10010352 325
70 3300012841 Ga0160444_100176 Ga0160444_10017642 325
71 3300012857 Ga0160435_1000866 Ga0160435_10008665 325
72 3300042598 Ga0466701_011131 Ga0466701_011131_10240_11217 325
73 3300042623 Ga0466734_136381 Ga0466734_136381_669_1646 325
74 iso_pr_bacteria 2855798354 2855800137 325
75 iso_pr_bacteria 2873571580 2873577040 325
76 iso_pr_bacteria 8100449422 8100450544 325
77 iso_pr_bacteria 8100455565 8100460854 325
78 iso_pr_bacteria 8100461708 8100467032 325
79 3300007095 Ga0102739_1004441 Ga0102739_10044412 326
80 3300012803 Ga0160465_100764 Ga0160465_1007646 326
81 3300012813 Ga0160470_100774 Ga0160470_1007746 326
82 3300012829 Ga0160467_100430 Ga0160467_10043011 326
83 3300012839 Ga0160472_101040 Ga0160472_10104010 326
84 3300042598 Ga0466701_007577 Ga0466701_007577_23120_24127 326
85 3300042598 Ga0466701_035715 Ga0466701_035715_14503_15483 326
86 3300042623 Ga0466734_082709 Ga0466734_082709_840_1820 326
87 3300042655 Ga0466727_311191 Ga0466727_311191_989_1969 326
88 iso_pr_bacteria 2864826666 2864830367 326
89 iso_pr_bacteria 2864937364 2864937632 326
90 iso_pr_bacteria 8024031916 8024036218 326
91 3300007067 Ga0103266_1000006 Ga0103266_1000006101 327
92 3300007068 Ga0103265_1001729 Ga0103265_10017293 327
93 3300007095 Ga0102739_1002380 Ga0102739_10023802 327
94 3300007129 Ga0102734_1003908 Ga0102734_10039082 327
95 3300007141 Ga0102738_1001119 Ga0102738_10011193 327
96 3300007192 Ga0103268_1000562 Ga0103268_10005628 327
97 3300042625 Ga0466730_008052 Ga0466730_008052_41442_42425 327
98 iso_pr_bacteria 8024031916 8024036808 327
99 iso_pr_bacteria 8100449422 8100452521 327
100 iso_pr_bacteria 8100455565 8100458587 327
101 iso_pr_bacteria 8100461708 8100462467 327
102 3300002931 CVPL010W_10000939 CVPL010W_1000093927 328
103 3300007129 Ga0102734_1022842 Ga0102734_10228422 328
104 3300007188 Ga0103264_1000171 Ga0103264_10001717 328
105 3300042623 Ga0466734_149222 Ga0466734_149222_393_1418 328
106 3300042625 Ga0466730_096842 Ga0466730_096842_29412_30398 328
107 3300042652 Ga0466708_449947 Ga0466708_449947_3783_4769 328
108 iso_pr_bacteria 2603880170 2606029457 328
109 iso_pr_bacteria 2687453742 2689989310 328
110 iso_pr_bacteria 2855798354 2855800817 328
111 3300002931 CVPL010W_10005673 CVPL010W_1000567323 329
112 3300002938 CVPL005L_10019727 CVPL005L_100197273 329
113 3300007080 Ga0102735_1000040 Ga0102735_100004019 329
114 3300007140 Ga0102740_1000423 Ga0102740_10004234 329
115 3300007140 Ga0102740_1002596 Ga0102740_10025962 329
116 3300007142 Ga0102737_1000020 Ga0102737_10000205 329
117 3300012809 Ga0160466_102622 Ga0160466_1026223 329
118 3300012849 Ga0160447_101135 Ga0160447_1011355 329
119 3300042582 Ga0466657_331938 Ga0466657_331938_1914_2903 329
120 3300042592 Ga0466693_414356 Ga0466693_414356_787_1776 329
121 3300042598 Ga0466701_021535 Ga0466701_021535_1846_2835 329
122 3300042654 Ga0466725_428176 Ga0466725_428176_272_1261 329
123 3300007052 Ga0102736_1002894 Ga0102736_10028942 330
124 3300007067 Ga0103266_1000194 Ga0103266_10001943 330
125 3300007142 Ga0102737_1002859 Ga0102737_10028595 330
126 3300007192 Ga0103268_1000781 Ga0103268_10007816 330
127 3300012839 Ga0160472_107782 Ga0160472_1077822 330
128 3300042625 Ga0466730_048836 Ga0466730_048836_23792_24784 330
129 3300007067 Ga0103266_1000260 Ga0103266_100026010 331
130 3300010882 Ga0123354_10232556 Ga0123354_102325562 331
131 3300012824 Ga0160469_100459 Ga0160469_1004598 331
132 3300012861 Ga0160436_1001113 Ga0160436_10011134 331
133 iso_pr_bacteria 2603880172 2606032886 331
134 iso_pr_bacteria 2864937364 2864943853 331
135 iso_pr_bacteria 2864937364 2864944094 331
136 iso_pr_bacteria 8024031916 8024036944 331
137 3300009784 Ga0123357_10088536 Ga0123357_100885362 332
138 3300012809 Ga0160466_104040 Ga0160466_1040402 332
139 iso_pr_bacteria 2603880172 2606034467 332
140 iso_pr_bacteria 8024031916 8024035708 332
141 iso_pr_bacteria 8024031916 8024035907 332
142 3300007083 Ga0103261_1000279 Ga0103261_10002794 333
143 3300009784 Ga0123357_10356138 Ga0123357_103561382 333
144 3300012839 Ga0160472_103754 Ga0160472_1037543 333
145 3300012845 Ga0160460_104242 Ga0160460_1042422 333
146 iso_pr_bacteria 8100449422 8100454856 333
147 iso_pr_bacteria 8100455565 8100456715 333
148 iso_pr_bacteria 8100461708 8100462248 333
149 3300012818 Ga0160432_100687 Ga0160432_10068713 334
150 3300042598 Ga0466701_086274 Ga0466701_086274_28174_29178 334
151 3300042649 Ga0466724_29472 Ga0466724_29472_326605_327609 334
152 iso_pr_bacteria 2864826666 2864829942 334
153 iso_pr_bacteria 2868169047 2868170653 334
154 3300042625 Ga0466730_035815 Ga0466730_035815_371_1378 335
155 3300042598 Ga0466701_076976 Ga0466701_076976_57649_58659 336
156 3300042649 Ga0466724_24188 Ga0466724_24188_141470_142480 336
157 3300012845 Ga0160460_102916 Ga0160460_1029161 337
158 iso_pr_bacteria 2873571580 2873576677 337
159 3300007083 Ga0103261_1001051 Ga0103261_10010513 338
160 3300007140 Ga0102740_1003935 Ga0102740_10039352 338
161 3300007192 Ga0103268_1000767 Ga0103268_10007671 339
162 3300012819 Ga0160468_100898 Ga0160468_10089810 340
163 3300012852 Ga0160430_105039 Ga0160430_1050393 340
164 3300042598 Ga0466701_081372 Ga0466701_081372_95495_96517 340
165 3300042623 Ga0466734_056962 Ga0466734_056962_146_1168 340
166 iso_pr_bacteria 8100449422 8100451369 340
167 iso_pr_bacteria 8100455565 8100461449 340
168 iso_pr_bacteria 8100461708 8100461792 340
169 3300012849 Ga0160447_103545 Ga0160447_1035455 341
170 3300012854 Ga0160448_103320 Ga0160448_1033203 342
171 3300012839 Ga0160472_100315 Ga0160472_10031524 343
172 3300012825 Ga0160441_103673 Ga0160441_1036733 346
173 3300042625 Ga0466730_030029 Ga0466730_030029_219896_221026 347
174 iso_pr_bacteria 2603880170 2606029246 348
175 3300002931 CVPL010W_10001691 CVPL010W_1000169118 349
176 3300002934 CVPL005W_1001365 CVPL005W_10013652 349
177 3300042598 Ga0466701_039104 Ga0466701_039104_43010_44059 349
178 3300042625 Ga0466730_012298 Ga0466730_012298_95996_97045 349
179 3300042598 Ga0466701_094535 Ga0466701_094535_6805_7860 351
180 3300042625 Ga0466730_007839 Ga0466730_007839_142781_143836 351
181 3300042643 Ga0466704_490148 Ga0466704_490148_343_1398 351
182 iso_pr_bacteria 8100449422 8100454709 351
183 iso_pr_bacteria 8100455565 8100461035 351
184 iso_pr_bacteria 8100461708 8100461948 351
185 3300042602 Ga0466713_036465 Ga0466713_036465_231_1301 356
186 3300012813 Ga0160470_100462 Ga0160470_1004626 357
187 3300012831 Ga0160459_100051 Ga0160459_10005121 357
188 3300010882 Ga0123354_10031282 Ga0123354_100312823 369
189 3300042598 Ga0466701_019646 Ga0466701_019646_24617_25741 374

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03401 TctC Tripartite tricarboxylate transporter family receptor 97 370 0.99

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
5oku-assembly1.cif.gz_A R. palustris Rpa4515 with adipate 0.972 77 372
8hkb-assembly1.cif.gz_A TPA bound-form of Periplasmic terephthalate binding protein (TBP) from Ideonella sakaiensis mutant K184D 0.968 80 374
2dvz-assembly1.cif.gz_A Structure of a periplasmic transporter 0.965 76 374
2f5x-assembly3.cif.gz_C Structure of periplasmic binding protein BugD 0.953 77 372
6hke-assembly1.cif.gz_A MatC (Rpa3494) from Rhodopseudomonas palustris with bound malate 0.948 77 366
IDDescriptionScoreStartEndSuperfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9597 176 298 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9486 176 294 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.935 76 374 3.40.190.150
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9307 77 372 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9307 77 374 3.40.190.150
IDDescriptionScoreStartEndGO Terms
AF-A0A1F4CWQ1-F1-model_v4 Uncharacterized/unreviewed 0.9731 68 374

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.