Protein Family IF05372

Metagenome Metatranscriptome Isolate
138 Members
57 Samples
128 Scaffolds
78.39 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_402435|Ga0466699_402435_138_413
Length
91 aa
Sequence
MLILSRKIDEKIMIGDNISVSVIEIRGDQVRIGVDAPKTVKVYRREVYDAILAENKAAAESKPVLPAVDFGGPQQQSAQLMTSNPVDKSKI

📊 Sample Types

Isolate 7.2%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.6%
Kalotermitidae 25.0%
Unclassified 19.6%
Rhinotermitidae 5.4%
Termopsidae 3.6%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
29 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
30 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
33 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
34 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
42 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
43 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
44 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
47 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
48 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
49 650716102 Treponema primitia ZAS-2 Isolate Unclassified
50 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
51 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
52 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
53 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
54 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
55 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
56 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_12929709 3300010049 Bacteria 596
2 Ga0123353_10549719 3300010167 Bacteria 1666
3 Ga0123353_12516517 3300010167 Bacteria 612
4 Ga0123354_10138275 3300010882 Bacteria 3031
5 Ga0466712_185026 3300042614 Bacteria 3456
6 Ga0466723_083074 3300042618 Bacteria 10782
7 Ga0466691_092773 3300042593 Bacteria 19552
8 Ga0466720_123457 3300042607 Bacteria 1287
9 Ga0466698_252791 3300042610 Bacteria 1244
10 Ga0466735_007718 3300042624 Bacteria 1024
11 Ga0466703_274089 3300042636 Bacteria 1830
12 Ga0466704_036076 3300042643 Bacteria 2623
13 AustNasuHG_c1002479 3300000089 Bacteria 6681
14 AustNasuHG_c1006176 3300000089 Bacteria 4281
15 JGI24702J35022_10020792 3300002462 Bacteria 3560
16 Ga0074263_104835 3300005485 Bacteria 1435
17 Ga0466705_343858 3300042612 Bacteria 7021
18 Ga0123356_11174350 3300010049 Bacteria 934
19 Ga0466718_072178 3300042617 Bacteria 1039
20 Ga0466723_347993 3300042618 Bacteria 25507
21 Ga0466690_254487 3300042590 Bacteria 4824
22 Ga0466692_077918 3300042591 Bacteria 6544
23 Ga0466691_082912 3300042593 Bacteria 11098
24 Ga0466699_432927 3300042597 Bacteria 2653
25 Ga0466706_059039 3300042599 Bacteria 1329
26 Ga0466716_293565 3300042605 Bacteria 4675
27 Ga0466719_404816 3300042606 Bacteria 3479
28 Ga0466722_082473 3300042609 Bacteria 31404
29 Ga0466708_076855 3300042652 Bacteria 5941
30 JGI24698J34947_10026985 3300002449 Bacteria 3048
31 JGI24697J35500_11205289 3300002507 Unclassified 1711
32 Ga0123357_10970907 3300009784 Bacteria 534
33 Ga0466723_207507 3300042618 Bacteria 5310
34 Ga0466728_414432 3300042620 Bacteria 5411
35 Ga0466690_373454 3300042590 Bacteria 1394
36 Ga0466692_013015 3300042591 Bacteria 22521
37 Ga0466692_060419 3300042591 Bacteria 15758
38 Ga0466691_073171 3300042593 Unclassified 2743
39 Ga0466699_057782 3300042597 Bacteria 4143
40 Ga0466699_344356 3300042597 Bacteria 1264
41 Ga0466722_205111 3300042609 Bacteria 5549
42 Ga0466735_206373 3300042624 Bacteria 1247
43 JGI24695J34938_10006193 3300002450 Bacteria 7268
44 JGI24702J35022_10124900 3300002462 Bacteria 1424
45 Ga0072940_1127224 3300005200 Bacteria 1136
46 Ga0072941_1003454 3300005201 Bacteria 7153
47 Ga0466732_011951 3300042656 Bacteria 13739
48 Ga0123356_12830623 3300010049 Bacteria 607
49 Ga0123353_11887890 3300010167 Bacteria 738
50 Ga0466712_128028 3300042614 Bacteria 17639
51 Ga0466711_022289 3300042615 Bacteria 20333
52 Ga0466726_454466 3300042619 Bacteria 1235
53 Ga0466728_032701 3300042620 Bacteria 12669
54 Ga0466690_086888 3300042590 Bacteria 9704
55 Ga0466692_031113 3300042591 Bacteria 7938
56 Ga0466716_461108 3300042605 Bacteria 1371
57 Ga0466698_429934 3300042610 Bacteria 1030
58 Ga0466702_187103 3300042635 Bacteria 1009
59 Ga0466708_183683 3300042652 Bacteria 5093
60 JGI24698J34947_10069069 3300002449 Bacteria 1706
61 Ga0072940_1105793 3300005200 Bacteria 2399
62 Ga0072941_1003453 3300005201 Bacteria 10168
63 Ga0123356_12003140 3300010049 Bacteria 722
64 Ga0123356_13554857 3300010049 Bacteria 540
65 Ga0123353_11874715 3300010167 Bacteria 741
66 Ga0466726_382045 3300042619 Bacteria 3614
67 Ga0466694_045169 3300042594 Bacteria 2741
68 Ga0466694_070159 3300042594 Bacteria 2159
69 Ga0466696_404855 3300042596 Bacteria 6845
70 Ga0466699_402435 3300042597 Bacteria 1905
71 Ga0466719_564357 3300042606 Bacteria 19436
72 Ga0466703_286947 3300042636 Bacteria 1527
73 Ga0466704_174279 3300042643 Bacteria 23732
74 Ga0466704_561052 3300042643 Bacteria 2688
75 AustNasuHG_c1000682 3300000089 Bacteria 12071
76 JGI24705J35276_11418814 3300002504 Bacteria 532
77 Ga0123357_10075728 3300009784 Bacteria 4447
78 Ga0123357_10167517 3300009784 Bacteria 2611
79 Ga0123357_10613547 3300009784 Bacteria 827
80 Ga0123354_10760316 3300010882 Bacteria 662
81 Ga0466712_226326 3300042614 Bacteria 1666
82 Ga0466711_281397 3300042615 Bacteria 4055
83 Ga0466718_097746 3300042617 Bacteria 1052
84 Ga0466723_120135 3300042618 Bacteria 3350
85 Ga0466728_476387 3300042620 Bacteria 4961
86 Ga0415639_023874 3300038395 Bacteria 2383
87 Ga0466694_161348 3300042594 Bacteria 1132
88 Ga0466719_164021 3300042606 Bacteria 3343
89 Ga0466722_123596 3300042609 Bacteria 3220
90 Ga0466722_176295 3300042609 Bacteria 1661
91 Ga0466735_157415 3300042624 Bacteria 1234
92 Ga0466703_012817 3300042636 Bacteria 5494
93 Ga0466709_350218 3300042648 Bacteria 8916
94 Ga0466705_080433 3300042612 Bacteria 3319
95 Ga0466732_249875 3300042656 Bacteria 5179
96 Ga0123355_10264781 3300009826 Bacteria 2398
97 Ga0123353_10040493 3300010167 Bacteria 7352
98 Ga0466712_078633 3300042614 Unclassified 4584
99 Ga0466715_485714 3300042616 Bacteria 27285
100 Ga0466718_047698 3300042617 Bacteria 18884
101 Ga0466723_348609 3300042618 Bacteria 1909
102 Ga0456237_0027672 3300041968 Bacteria 767
103 Ga0456237_0042238 3300041968 Bacteria 601
104 Ga0466693_172378 3300042592 Bacteria 4870
105 Ga0466696_422507 3300042596 Bacteria 2111
106 Ga0466699_308724 3300042597 Bacteria 1827
107 Ga0466707_056938 3300042601 Bacteria 3811
108 Ga0466704_207868 3300042643 Bacteria 15581
109 Ga0466708_226192 3300042652 Bacteria 21675
110 Ga0466708_355996 3300042652 Bacteria 1164
111 JGI24698J34947_10006948 3300002449 Bacteria 6223
112 JGI24698J34947_10161168 3300002449 Bacteria 919
113 JGI24702J35022_10002060 3300002462 Unclassified 12402
114 JGI24705J35276_12229625 3300002504 Bacteria 3427
115 Ga0072940_1261790 3300005200 Bacteria 1035
116 Ga0123355_10175824 3300009826 Bacteria 3188
117 Ga0123353_11075375 3300010167 Bacteria 1071
118 Ga0123353_11205948 3300010167 Bacteria 993
119 Ga0123353_12320602 3300010167 Bacteria 644
120 Ga0466723_046084 3300042618 Bacteria 2846
121 Ga0255786_1002184 3300022815 Unclassified 1222
122 Ga0466690_302806 3300042590 Bacteria 1812
123 Ga0466695_139683 3300042595 Bacteria 7187
124 Ga0466707_253066 3300042601 Bacteria 1587
125 Ga0466708_044472 3300042652 Bacteria 26279
126 JGI24698J34947_10017513 3300002449 Unclassified 3881
127 JGI24702J35022_10752595 3300002462 Bacteria 606
128 JGI24705J35276_12207011 3300002504 Bacteria 1734

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300041968 Ga0456237_0027672 Ga0456237_0027672_27_248 73
2 3300042590 Ga0466690_302806 Ga0466690_302806_1579_1800 73
3 3300042591 Ga0466692_031113 Ga0466692_031113_1355_1576 73
4 3300042591 Ga0466692_077918 Ga0466692_077918_4736_4957 73
5 3300042605 Ga0466716_293565 Ga0466716_293565_275_496 73
6 3300042609 Ga0466722_082473 Ga0466722_082473_3215_3436 73
7 3300042610 Ga0466698_252791 Ga0466698_252791_795_1016 73
8 3300042618 Ga0466723_120135 Ga0466723_120135_656_877 73
9 3300042619 Ga0466726_454466 Ga0466726_454466_560_781 73
10 3300042652 Ga0466708_044472 Ga0466708_044472_14725_14946 73
11 3300002449 JGI24698J34947_10161168 JGI24698J34947_101611682 74
12 3300042595 Ga0466695_139683 Ga0466695_139683_6647_6871 74
13 3300042596 Ga0466696_422507 Ga0466696_422507_764_988 74
14 3300042612 Ga0466705_343858 Ga0466705_343858_1254_1478 74
15 3300042615 Ga0466711_281397 Ga0466711_281397_2923_3147 74
16 3300042619 Ga0466726_382045 Ga0466726_382045_2369_2593 74
17 3300042636 Ga0466703_012817 Ga0466703_012817_3438_3662 74
18 iso_pr_bacteria 2781125641 2781290797 74
19 3300010167 Ga0123353_12320602 Ga0123353_123206022 75
20 3300042601 Ga0466707_056938 Ga0466707_056938_2186_2413 75
21 3300000089 AustNasuHG_c1000682 AustNasuHG_100068215 76
22 3300042590 Ga0466690_086888 Ga0466690_086888_6767_6997 76
23 3300042594 Ga0466694_070159 Ga0466694_070159_297_527 76
24 3300042606 Ga0466719_404816 Ga0466719_404816_2103_2333 76
25 3300042610 Ga0466698_429934 Ga0466698_429934_713_943 76
26 3300042617 Ga0466718_047698 Ga0466718_047698_9053_9283 76
27 3300042656 Ga0466732_249875 Ga0466732_249875_1640_1870 76
28 iso_pr_bacteria 2781125629 2781263869 76
29 3300002504 JGI24705J35276_11418814 JGI24705J35276_114188141 77
30 3300005200 Ga0072940_1105793 Ga0072940_11057933 77
31 3300005200 Ga0072940_1261790 Ga0072940_12617902 77
32 3300022815 Ga0255786_1002184 Ga0255786_10021842 77
33 3300038395 Ga0415639_023874 Ga0415639_023874_1670_1903 77
34 3300042590 Ga0466690_254487 Ga0466690_254487_4293_4526 77
35 3300042590 Ga0466690_373454 Ga0466690_373454_1083_1316 77
36 3300042591 Ga0466692_013015 Ga0466692_013015_14037_14270 77
37 3300042591 Ga0466692_060419 Ga0466692_060419_10842_11075 77
38 3300042593 Ga0466691_073171 Ga0466691_073171_973_1206 77
39 3300042593 Ga0466691_082912 Ga0466691_082912_6089_6322 77
40 3300042593 Ga0466691_092773 Ga0466691_092773_18921_19154 77
41 3300042594 Ga0466694_045169 Ga0466694_045169_1929_2162 77
42 3300042594 Ga0466694_161348 Ga0466694_161348_53_286 77
43 3300042597 Ga0466699_308724 Ga0466699_308724_887_1120 77
44 3300042599 Ga0466706_059039 Ga0466706_059039_1056_1289 77
45 3300042601 Ga0466707_253066 Ga0466707_253066_943_1176 77
46 3300042605 Ga0466716_461108 Ga0466716_461108_301_534 77
47 3300042606 Ga0466719_164021 Ga0466719_164021_725_958 77
48 3300042606 Ga0466719_564357 Ga0466719_564357_9310_9543 77
49 3300042607 Ga0466720_123457 Ga0466720_123457_492_725 77
50 3300042609 Ga0466722_123596 Ga0466722_123596_2920_3153 77
51 3300042609 Ga0466722_176295 Ga0466722_176295_850_1083 77
52 3300042612 Ga0466705_080433 Ga0466705_080433_1618_1851 77
53 3300042614 Ga0466712_185026 Ga0466712_185026_1420_1653 77
54 3300042615 Ga0466711_022289 Ga0466711_022289_12144_12377 77
55 3300042616 Ga0466715_485714 Ga0466715_485714_26423_26656 77
56 3300042618 Ga0466723_046084 Ga0466723_046084_305_538 77
57 3300042618 Ga0466723_083074 Ga0466723_083074_4152_4385 77
58 3300042618 Ga0466723_207507 Ga0466723_207507_609_842 77
59 3300042618 Ga0466723_348609 Ga0466723_348609_1541_1774 77
60 3300042620 Ga0466728_476387 Ga0466728_476387_4665_4898 77
61 3300042624 Ga0466735_007718 Ga0466735_007718_482_715 77
62 3300042624 Ga0466735_157415 Ga0466735_157415_227_460 77
63 3300042624 Ga0466735_206373 Ga0466735_206373_84_317 77
64 3300042635 Ga0466702_187103 Ga0466702_187103_539_772 77
65 3300042636 Ga0466703_274089 Ga0466703_274089_339_572 77
66 3300042636 Ga0466703_286947 Ga0466703_286947_545_778 77
67 3300042643 Ga0466704_036076 Ga0466704_036076_94_327 77
68 3300042643 Ga0466704_174279 Ga0466704_174279_18381_18614 77
69 3300042643 Ga0466704_561052 Ga0466704_561052_915_1148 77
70 3300042652 Ga0466708_076855 Ga0466708_076855_4890_5123 77
71 3300042652 Ga0466708_183683 Ga0466708_183683_4732_4965 77
72 3300042652 Ga0466708_226192 Ga0466708_226192_5073_5306 77
73 3300042652 Ga0466708_355996 Ga0466708_355996_607_840 77
74 iso_pr_bacteria 2781125652 2781312656 77
75 iso_pr_bacteria 2781125686 2781419318 77
76 iso_pr_bacteria 2781125691 2781429549 77
77 iso_pr_bacteria 650716102 650882810 77
78 3300002449 JGI24698J34947_10006948 JGI24698J34947_100069487 78
79 3300002449 JGI24698J34947_10017513 JGI24698J34947_100175133 78
80 3300002449 JGI24698J34947_10026985 JGI24698J34947_100269853 78
81 3300002462 JGI24702J35022_10002060 JGI24702J35022_100020608 78
82 3300002462 JGI24702J35022_10020792 JGI24702J35022_100207924 78
83 3300002462 JGI24702J35022_10124900 JGI24702J35022_101249002 78
84 3300002462 JGI24702J35022_10752595 JGI24702J35022_107525951 78
85 3300002504 JGI24705J35276_12207011 JGI24705J35276_122070113 78
86 3300002504 JGI24705J35276_12229625 JGI24705J35276_122296254 78
87 3300005200 Ga0072940_1127224 Ga0072940_11272242 78
88 3300005485 Ga0074263_104835 Ga0074263_1048352 78
89 3300009784 Ga0123357_10075728 Ga0123357_100757284 78
90 3300009784 Ga0123357_10167517 Ga0123357_101675173 78
91 3300009826 Ga0123355_10175824 Ga0123355_101758242 78
92 3300010049 Ga0123356_12929709 Ga0123356_129297091 78
93 3300010049 Ga0123356_13554857 Ga0123356_135548572 78
94 3300010167 Ga0123353_10040493 Ga0123353_100404935 78
95 3300010167 Ga0123353_12516517 Ga0123353_125165172 78
96 3300010882 Ga0123354_10138275 Ga0123354_101382754 78
97 3300010882 Ga0123354_10760316 Ga0123354_107603162 78
98 3300042609 Ga0466722_205111 Ga0466722_205111_194_430 78
99 3300042617 Ga0466718_097746 Ga0466718_097746_483_719 78
100 iso_pr_bacteria 2781125692 2781430338 78
101 3300010167 Ga0123353_11887890 Ga0123353_118878902 79
102 3300041968 Ga0456237_0042238 Ga0456237_0042238_16_255 79
103 3300042614 Ga0466712_078633 Ga0466712_078633_4315_4554 79
104 3300042614 Ga0466712_128028 Ga0466712_128028_10232_10471 79
105 3300042620 Ga0466728_032701 Ga0466728_032701_5988_6227 79
106 3300002449 JGI24698J34947_10069069 JGI24698J34947_100690692 80
107 3300002507 JGI24697J35500_11205289 JGI24697J35500_112052893 80
108 3300005201 Ga0072941_1003453 Ga0072941_10034539 80
109 3300005201 Ga0072941_1003454 Ga0072941_10034543 80
110 3300042618 Ga0466723_347993 Ga0466723_347993_20422_20664 80
111 3300042648 Ga0466709_350218 Ga0466709_350218_6738_6980 80
112 3300010049 Ga0123356_11174350 Ga0123356_111743502 81
113 3300042596 Ga0466696_404855 Ga0466696_404855_5730_5975 81
114 3300042617 Ga0466718_072178 Ga0466718_072178_269_514 81
115 3300042643 Ga0466704_207868 Ga0466704_207868_2153_2398 81
116 3300009784 Ga0123357_10613547 Ga0123357_106135472 84
117 3300009784 Ga0123357_10970907 Ga0123357_109709071 84
118 3300010167 Ga0123353_10549719 Ga0123353_105497192 84
119 3300010167 Ga0123353_11075375 Ga0123353_110753752 84
120 3300010167 Ga0123353_11205948 Ga0123353_112059482 84
121 3300010167 Ga0123353_11874715 Ga0123353_118747152 84
122 3300042592 Ga0466693_172378 Ga0466693_172378_4389_4643 84
123 3300042597 Ga0466699_344356 Ga0466699_344356_217_471 84
124 3300042620 Ga0466728_414432 Ga0466728_414432_4674_4928 84
125 iso_pr_bacteria 2781125693 2781433276 84
126 3300042597 Ga0466699_057782 Ga0466699_057782_712_969 85
127 3300042614 Ga0466712_226326 Ga0466712_226326_213_470 85
128 3300010049 Ga0123356_12003140 Ga0123356_120031402 86
129 3300010049 Ga0123356_12830623 Ga0123356_128306232 86
130 3300042656 Ga0466732_011951 Ga0466732_011951_13258_13518 86
131 iso_pr_bacteria 2781125640 2781288159 86
132 3300000089 AustNasuHG_c1006176 AustNasuHG_10061766 87
133 3300002450 JGI24695J34938_10006193 JGI24695J34938_100061933 87
134 3300000089 AustNasuHG_c1002479 AustNasuHG_10024798 88
135 3300042597 Ga0466699_432927 Ga0466699_432927_852_1118 88
136 iso_pr_bacteria 2781125658 2781326410 88
137 3300009826 Ga0123355_10264781 Ga0123355_102647813 89
138 3300042597 Ga0466699_402435 Ga0466699_402435_138_413 91

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02599 CsrA Global regulator protein family 1 51 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.53 0.71 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.