Protein Family IF05370

Metagenome Isolate
138 Members
47 Samples
131 Scaffolds
235.38 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_391961|Ga0466699_391961_3858_4652
Length
264 aa
Sequence
MIHNNRKVNPYDTPLDTNSPNQYLITIRRNPMIQLPLAGSDKKITINPSKIIAVGLNYREHIKESLTFGDKPHDLPKEPVLFAKTTNVLIGPGEPIVIPAHIKEYNFEDERVDPECELAIIIGKRGRHIPEEKAFDYVLGYTCFNDVSQRNIQKSDPSGWFRGKSFDTFGPIGPVIVSHNDIGNPQALNVTCKINGVLKQSGNTAEMIFPLPVLISYISKQFTLEEGDVIATGTPSGISPIVPGDTVEVEIEKIGILRNPVTAE

📊 Sample Types

Isolate 5.1%
Metagenome 94.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.3%
Kalotermitidae 29.8%
Unclassified 17.0%
Rhinotermitidae 8.5%
Termopsidae 6.4%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
2 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
19 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
38 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
39 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
43 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
44 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
45 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_173907 3300042624 Bacteria 1487
2 Ga0466709_209315 3300042648 Bacteria 6549
3 Ga0466727_184612 3300042655 Bacteria 12843
4 Ga0466690_182141 3300042590 Bacteria 3883
5 Ga0466691_069494 3300042593 Bacteria 5723
6 Ga0466699_044841 3300042597 Bacteria 2170
7 Ga0466712_122274 3300042614 Bacteria 1302
8 Ga0466715_219377 3300042616 Bacteria 3736
9 Ga0466715_398268 3300042616 Bacteria 4524
10 Ga0466715_507006 3300042616 Bacteria 1384
11 Ga0466700_287812 3300042600 Bacteria 1307
12 Ga0466716_166989 3300042605 Bacteria 1435
13 Ga0123356_10485816 3300010049 Bacteria 1389
14 Ga0466705_062998 3300042612 Bacteria 6202
15 Ga0466705_123366 3300042612 Bacteria 3839
16 JGI24702J35022_10011288 3300002462 Bacteria 4980
17 JGI24702J35022_10168290 3300002462 Bacteria 1238
18 JGI24705J35276_12220830 3300002504 Bacteria 2293
19 Ga0466729_248528 3300042621 Bacteria 1295
20 Ga0466729_302655 3300042621 Bacteria 1731
21 Ga0466735_219380 3300042624 Bacteria 1502
22 Ga0466704_293514 3300042643 Bacteria 5518
23 Ga0466709_204865 3300042648 Bacteria 1771
24 Ga0466708_247180 3300042652 Bacteria 6066
25 Ga0466694_045629 3300042594 Bacteria 1124
26 Ga0466699_391961 3300042597 Bacteria 4868
27 Ga0466711_482729 3300042615 Bacteria 7454
28 Ga0466715_045624 3300042616 Bacteria 12736
29 Ga0466728_087613 3300042620 Bacteria 22622
30 Ga0466728_341928 3300042620 Bacteria 4971
31 Ga0466728_381622 3300042620 Bacteria 6445
32 Ga0466722_032150 3300042609 Bacteria 5466
33 Ga0123353_10163001 3300010167 Bacteria 3547
34 Ga0123353_10402425 3300010167 Bacteria 2037
35 Ga0123353_10587140 3300010167 Bacteria 1596
36 JGI24702J35022_10009800 3300002462 Bacteria 5370
37 JGI24702J35022_10080351 3300002462 Bacteria 1766
38 Ga0123357_10000061 3300009784 Bacteria 85874
39 Ga0466704_348330 3300042643 Bacteria 22818
40 Ga0466704_349883 3300042643 Bacteria 6408
41 Ga0466708_040831 3300042652 Bacteria 1540
42 Ga0466727_111549 3300042655 Bacteria 1684
43 Ga0456237_0006641 3300041968 Bacteria 1805
44 Ga0466692_001784 3300042591 Bacteria 8377
45 Ga0466692_083130 3300042591 Bacteria 2889
46 Ga0466691_059522 3300042593 Bacteria 11088
47 Ga0466712_203843 3300042614 Bacteria 11185
48 Ga0466712_205602 3300042614 Bacteria 11927
49 Ga0466715_342340 3300042616 Bacteria 4967
50 Ga0466715_641799 3300042616 Bacteria 5422
51 Ga0466723_126188 3300042618 Bacteria 2922
52 Ga0466726_192760 3300042619 Bacteria 6394
53 Ga0466716_283417 3300042605 Bacteria 15850
54 Ga0466719_235561 3300042606 Bacteria 1159
55 Ga0123355_10019401 3300009826 Bacteria 10826
56 Ga0123353_10123215 3300010167 Bacteria 4166
57 Ga0123354_10324917 3300010882 Bacteria 1413
58 Ga0123354_10382907 3300010882 Bacteria 1212
59 Ga0466705_093453 3300042612 Bacteria 20079
60 JGI24698J34947_10051143 3300002449 Bacteria 2080
61 Ga0466709_012349 3300042648 Bacteria 25902
62 Ga0466708_284625 3300042652 Bacteria 6267
63 Ga0456237_0000545 3300041968 Bacteria 5739
64 Ga0466696_020828 3300042596 Bacteria 4228
65 Ga0466699_309354 3300042597 Bacteria 2677
66 Ga0466715_503026 3300042616 Bacteria 1375
67 Ga0466723_084496 3300042618 Bacteria 9020
68 Ga0466726_013646 3300042619 Bacteria 1086
69 Ga0466716_023346 3300042605 Bacteria 3241
70 Ga0123354_10327261 3300010882 Bacteria 1403
71 JGI24698J34947_10016692 3300002449 Unclassified 3983
72 JGI24695J34938_10068326 3300002450 Bacteria 1493
73 Ga0466704_361364 3300042643 Bacteria 1406
74 Ga0466708_320263 3300042652 Bacteria 2815
75 Ga0466727_244714 3300042655 Bacteria 1475
76 Ga0466694_244121 3300042594 Bacteria 8492
77 Ga0466699_138614 3300042597 Bacteria 2628
78 Ga0466699_206795 3300042597 Unclassified 2080
79 Ga0466715_371870 3300042616 Bacteria 2485
80 Ga0466723_099808 3300042618 Bacteria 1912
81 Ga0466728_297992 3300042620 Bacteria 1546
82 Ga0466707_386472 3300042601 Bacteria 1940
83 Ga0123357_10245972 3300009784 Bacteria 1926
84 Ga0123356_10541488 3300010049 Bacteria 1324
85 Ga0123353_10161068 3300010167 Bacteria 3572
86 Ga0123353_10297345 3300010167 Bacteria 2467
87 JGI24698J34947_10001764 3300002449 Bacteria 11529
88 Ga0466709_064420 3300042648 Bacteria 20812
89 Ga0466696_209387 3300042596 Bacteria 2258
90 Ga0466712_039038 3300042614 Bacteria 39310
91 Ga0466715_026615 3300042616 Bacteria 1207
92 Ga0466715_074473 3300042616 Bacteria 4742
93 Ga0123357_10180888 3300009784 Bacteria 2462
94 Ga0123353_10803280 3300010167 Bacteria 1298
95 Ga0123353_11238659 3300010167 Bacteria 975
96 Ga0123354_10465150 3300010882 Bacteria 1012
97 Ga0466705_134384 3300042612 Bacteria 2720
98 JGI24698J34947_10005247 3300002449 Bacteria 7110
99 JGI24698J34947_10022614 3300002449 Bacteria 3370
100 JGI24700J35501_10930900 3300002508 Bacteria 36836
101 Ga0466703_096245 3300042636 Bacteria 24356
102 Ga0466703_102880 3300042636 Bacteria 2268
103 Ga0466704_198295 3300042643 Bacteria 6279
104 Ga0466704_604602 3300042643 Bacteria 3473
105 Ga0415639_157759 3300038395 Unclassified 1103
106 Ga0466699_135192 3300042597 Bacteria 1731
107 Ga0466712_170442 3300042614 Bacteria 1456
108 Ga0466707_148278 3300042601 Bacteria 1054
109 Ga0466722_089713 3300042609 Bacteria 16413
110 Ga0123355_10001378 3300009826 Bacteria 33829
111 Ga0123353_10526488 3300010167 Bacteria 1713
112 Ga0123354_10048261 3300010882 Bacteria 6477
113 JGI24698J34947_10000158 3300002449 Bacteria 25936
114 JGI24698J34947_10026404 3300002449 Bacteria 3086
115 Ga0466704_021624 3300042643 Bacteria 9498
116 Ga0466694_190203 3300042594 Bacteria 3364
117 Ga0466694_273673 3300042594 Bacteria 1695
118 Ga0466695_168570 3300042595 Bacteria 1973
119 Ga0466705_484253 3300042612 Bacteria 10481
120 Ga0466712_009972 3300042614 Bacteria 29783
121 Ga0466712_079618 3300042614 Unclassified 3459
122 Ga0466712_313318 3300042614 Bacteria 28274
123 Ga0466718_011124 3300042617 Bacteria 10964
124 Ga0466726_227930 3300042619 Bacteria 5980
125 Ga0466707_347807 3300042601 Bacteria 1189
126 Ga0466716_191381 3300042605 Bacteria 1026
127 Ga0466719_450751 3300042606 Bacteria 6981
128 Ga0466720_099690 3300042607 Bacteria 2693
129 Ga0466722_228701 3300042609 Bacteria 35562
130 Ga0123353_10203806 3300010167 Bacteria 3109
131 Ga0123353_10549016 3300010167 Bacteria 1667

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2781125632 2781271719 219
2 3300042591 Ga0466692_001784 Ga0466692_001784_3316_3978 220
3 3300041968 Ga0456237_0000545 Ga0456237_0000545_1502_2167 221
4 3300010167 Ga0123353_10297345 Ga0123353_102973453 223
5 3300042616 Ga0466715_371870 Ga0466715_371870_436_1116 226
6 3300042616 Ga0466715_507006 Ga0466715_507006_438_1118 226
7 3300042612 Ga0466705_134384 Ga0466705_134384_1627_2310 227
8 3300042643 Ga0466704_604602 Ga0466704_604602_2779_3462 227
9 3300042609 Ga0466722_032150 Ga0466722_032150_2860_3546 228
10 3300042609 Ga0466722_089713 Ga0466722_089713_925_1620 231
11 3300010167 Ga0123353_10123215 Ga0123353_101232152 232
12 3300042590 Ga0466690_182141 Ga0466690_182141_317_1015 232
13 3300042593 Ga0466691_069494 Ga0466691_069494_3626_4324 232
14 3300042615 Ga0466711_482729 Ga0466711_482729_3267_3965 232
15 3300042616 Ga0466715_074473 Ga0466715_074473_914_1612 232
16 3300042616 Ga0466715_342340 Ga0466715_342340_3019_3717 232
17 3300042616 Ga0466715_503026 Ga0466715_503026_239_937 232
18 3300042643 Ga0466704_349883 Ga0466704_349883_5199_5897 232
19 3300042643 Ga0466704_361364 Ga0466704_361364_348_1046 232
20 3300042648 Ga0466709_204865 Ga0466709_204865_396_1094 232
21 3300042652 Ga0466708_284625 Ga0466708_284625_2973_3671 232
22 3300042594 Ga0466694_045629 Ga0466694_045629_165_866 233
23 3300042594 Ga0466694_190203 Ga0466694_190203_2163_2864 233
24 3300042594 Ga0466694_273673 Ga0466694_273673_496_1197 233
25 3300042597 Ga0466699_044841 Ga0466699_044841_298_999 233
26 3300042597 Ga0466699_138614 Ga0466699_138614_1914_2615 233
27 3300042597 Ga0466699_206795 Ga0466699_206795_694_1395 233
28 3300042601 Ga0466707_347807 Ga0466707_347807_366_1067 233
29 3300042601 Ga0466707_386472 Ga0466707_386472_131_832 233
30 3300042605 Ga0466716_023346 Ga0466716_023346_1620_2321 233
31 3300042612 Ga0466705_062998 Ga0466705_062998_5209_5910 233
32 3300042619 Ga0466726_192760 Ga0466726_192760_3977_4678 233
33 3300042620 Ga0466728_381622 Ga0466728_381622_14_715 233
34 3300042624 Ga0466735_173907 Ga0466735_173907_464_1165 233
35 3300042643 Ga0466704_021624 Ga0466704_021624_6934_7635 233
36 3300042652 Ga0466708_247180 Ga0466708_247180_203_904 233
37 3300042655 Ga0466727_184612 Ga0466727_184612_7661_8362 233
38 iso_pr_bacteria 2781125655 2781317438 233
39 3300002462 JGI24702J35022_10009800 JGI24702J35022_100098005 234
40 3300002462 JGI24702J35022_10011288 JGI24702J35022_100112884 234
41 3300002462 JGI24702J35022_10080351 JGI24702J35022_100803512 234
42 3300002504 JGI24705J35276_12220830 JGI24705J35276_122208302 234
43 3300010049 Ga0123356_10541488 Ga0123356_105414882 234
44 3300010167 Ga0123353_10163001 Ga0123353_101630012 234
45 3300010167 Ga0123353_10203806 Ga0123353_102038062 234
46 3300010167 Ga0123353_10402425 Ga0123353_104024253 234
47 3300010167 Ga0123353_10549016 Ga0123353_105490162 234
48 3300010167 Ga0123353_11238659 Ga0123353_112386592 234
49 3300042596 Ga0466696_020828 Ga0466696_020828_3495_4199 234
50 3300042607 Ga0466720_099690 Ga0466720_099690_737_1441 234
51 3300042614 Ga0466712_009972 Ga0466712_009972_25430_26134 234
52 3300042614 Ga0466712_039038 Ga0466712_039038_6373_7077 234
53 3300042614 Ga0466712_170442 Ga0466712_170442_37_741 234
54 3300042617 Ga0466718_011124 Ga0466718_011124_5246_5950 234
55 3300042618 Ga0466723_126188 Ga0466723_126188_1940_2644 234
56 3300042619 Ga0466726_013646 Ga0466726_013646_57_761 234
57 3300042655 Ga0466727_111549 Ga0466727_111549_863_1567 234
58 iso_pr_bacteria 2781125666 2781342957 234
59 iso_pr_bacteria 2781125681 2781407052 234
60 iso_pr_bacteria 2781125688 2781423178 234
61 iso_pr_bacteria 2819994798 2819998195 234
62 3300002449 JGI24698J34947_10000158 JGI24698J34947_1000015810 235
63 3300002462 JGI24702J35022_10168290 JGI24702J35022_101682902 235
64 3300002508 JGI24700J35501_10930900 JGI24700J35501_1093090019 235
65 3300009784 Ga0123357_10000061 Ga0123357_1000006155 235
66 3300009784 Ga0123357_10245972 Ga0123357_102459722 235
67 3300010049 Ga0123356_10485816 Ga0123356_104858162 235
68 3300010167 Ga0123353_10161068 Ga0123353_101610683 235
69 3300010167 Ga0123353_10526488 Ga0123353_105264882 235
70 3300010167 Ga0123353_10587140 Ga0123353_105871402 235
71 3300010882 Ga0123354_10382907 Ga0123354_103829071 235
72 3300041968 Ga0456237_0006641 Ga0456237_0006641_549_1256 235
73 3300042591 Ga0466692_083130 Ga0466692_083130_1172_1879 235
74 3300042596 Ga0466696_209387 Ga0466696_209387_587_1294 235
75 3300042605 Ga0466716_166989 Ga0466716_166989_361_1068 235
76 3300042606 Ga0466719_235561 Ga0466719_235561_219_926 235
77 3300042612 Ga0466705_123366 Ga0466705_123366_3023_3730 235
78 3300042614 Ga0466712_079618 Ga0466712_079618_1424_2131 235
79 3300042614 Ga0466712_205602 Ga0466712_205602_10161_10868 235
80 3300042616 Ga0466715_398268 Ga0466715_398268_2920_3627 235
81 3300042616 Ga0466715_641799 Ga0466715_641799_4466_5173 235
82 3300042618 Ga0466723_084496 Ga0466723_084496_3501_4208 235
83 3300042618 Ga0466723_099808 Ga0466723_099808_354_1061 235
84 3300042619 Ga0466726_227930 Ga0466726_227930_3558_4265 235
85 3300042620 Ga0466728_341928 Ga0466728_341928_2367_3074 235
86 3300042621 Ga0466729_248528 Ga0466729_248528_69_776 235
87 3300042648 Ga0466709_012349 Ga0466709_012349_11190_11897 235
88 3300042652 Ga0466708_320263 Ga0466708_320263_1570_2277 235
89 iso_pr_bacteria 2781125653 2781313159 235
90 3300002449 JGI24698J34947_10001764 JGI24698J34947_1000176410 236
91 3300002449 JGI24698J34947_10005247 JGI24698J34947_100052474 236
92 3300002449 JGI24698J34947_10016692 JGI24698J34947_100166922 236
93 3300002449 JGI24698J34947_10022614 JGI24698J34947_100226142 236
94 3300002450 JGI24695J34938_10068326 JGI24695J34938_100683262 236
95 3300009784 Ga0123357_10180888 Ga0123357_101808882 236
96 3300009826 Ga0123355_10019401 Ga0123355_100194017 236
97 3300010882 Ga0123354_10324917 Ga0123354_103249172 236
98 3300010882 Ga0123354_10327261 Ga0123354_103272612 236
99 3300042594 Ga0466694_244121 Ga0466694_244121_6453_7163 236
100 3300042597 Ga0466699_309354 Ga0466699_309354_152_862 236
101 3300042606 Ga0466719_450751 Ga0466719_450751_1115_1825 236
102 3300042614 Ga0466712_122274 Ga0466712_122274_164_874 236
103 3300042614 Ga0466712_203843 Ga0466712_203843_6732_7442 236
104 3300042614 Ga0466712_313318 Ga0466712_313318_2119_2829 236
105 3300002449 JGI24698J34947_10026404 JGI24698J34947_100264042 237
106 3300002449 JGI24698J34947_10051143 JGI24698J34947_100511432 237
107 3300010167 Ga0123353_10803280 Ga0123353_108032802 237
108 3300042601 Ga0466707_148278 Ga0466707_148278_324_1037 237
109 3300042616 Ga0466715_045624 Ga0466715_045624_4096_4809 237
110 3300042620 Ga0466728_297992 Ga0466728_297992_566_1279 237
111 3300009826 Ga0123355_10001378 Ga0123355_100013783 238
112 3300042600 Ga0466700_287812 Ga0466700_287812_220_936 238
113 3300042609 Ga0466722_228701 Ga0466722_228701_6515_7231 238
114 3300042624 Ga0466735_219380 Ga0466735_219380_497_1213 238
115 3300042643 Ga0466704_293514 Ga0466704_293514_4659_5375 238
116 3300042643 Ga0466704_348330 Ga0466704_348330_18676_19392 238
117 3300042652 Ga0466708_040831 Ga0466708_040831_410_1126 238
118 3300042597 Ga0466699_135192 Ga0466699_135192_105_824 239
119 3300042636 Ga0466703_096245 Ga0466703_096245_4301_5020 239
120 3300038395 Ga0415639_157759 Ga0415639_157759_294_1016 240
121 3300042643 Ga0466704_198295 Ga0466704_198295_1862_2584 240
122 3300042648 Ga0466709_064420 Ga0466709_064420_19164_19886 240
123 3300042655 Ga0466727_244714 Ga0466727_244714_621_1343 240
124 3300042605 Ga0466716_283417 Ga0466716_283417_680_1405 241
125 3300042595 Ga0466695_168570 Ga0466695_168570_147_875 242
126 3300042605 Ga0466716_191381 Ga0466716_191381_169_897 242
127 3300042612 Ga0466705_093453 Ga0466705_093453_18359_19087 242
128 3300042636 Ga0466703_102880 Ga0466703_102880_59_787 242
129 3300042616 Ga0466715_219377 Ga0466715_219377_922_1653 243
130 3300042612 Ga0466705_484253 Ga0466705_484253_8415_9149 244
131 3300042620 Ga0466728_087613 Ga0466728_087613_1853_2587 244
132 3300042621 Ga0466729_302655 Ga0466729_302655_913_1647 244
133 3300042616 Ga0466715_026615 Ga0466715_026615_359_1099 246
134 3300010882 Ga0123354_10048261 Ga0123354_100482612 247
135 3300042648 Ga0466709_209315 Ga0466709_209315_4330_5073 247
136 3300010882 Ga0123354_10465150 Ga0123354_104651501 248
137 3300042593 Ga0466691_059522 Ga0466691_059522_2969_3745 258
138 3300042597 Ga0466699_391961 Ga0466699_391961_3858_4652 264

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family 50 261 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01557 GO:0003824 catalytic activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.