Protein Family IF05365

Metagenome Isolate
110 Members
37 Samples
105 Scaffolds
306.68 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_358612|Ga0466699_358612_12080_13072
Length
330 aa
Sequence
MPAFNHTVTEILPGDLHCKIRLDCYIAEYLGLLSRSQIKARGLEAKINGKNVKISRTVKGGDFLELSWNEAEPLNLIPENIPLDILYEDRRVVVLNKPQGMVVHPGAGNRRGTLANALYFRRLEQAHPEFDTTFHVEGQRPGIVHRLDKETSGVMIAASDDGALAFLSGQFKARKTKKTYIAIVHGIPKEQKGRIETCIARDPKDRKRFTVAALGKYALTYYSVLKTWQLDAMNNHRYSLVMLRPKTGRTHQLRVHLRYLGHSIIGDPLYGFTDPLFPQASLMLHSRRLAITLPGEQNERVFKAPLPERFTVMIRFLNNAHQGTEAQSGI

📊 Sample Types

Isolate 4.5%
Metagenome 95.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.4%
Kalotermitidae 25.7%
Unclassified 14.3%
Termopsidae 2.9%
Rhinotermitidae 2.9%
Blaberidae 2.9%

🌳 Taxonomy

Archaea 0
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
2 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
3 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
4 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
5 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
11 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
21 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
22 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
23 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
24 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
25 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
26 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
35 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 2772190975 Treponema sp. RmG30 Isolate Blaberidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_226582 3300042614 Bacteria 5154
2 Ga0466711_307867 3300042615 Bacteria 4809
3 Ga0466718_032132 3300042617 Bacteria 1279
4 Ga0123356_10000125 3300010049 Bacteria 84722
5 Ga0466731_317461 3300042622 Bacteria 4069
6 Ga0466702_379929 3300042635 Bacteria 1757
7 Ga0415639_016295 3300038395 Bacteria 3938
8 Ga0415639_022188 3300038395 Bacteria 15573
9 Ga0466699_159060 3300042597 Bacteria 4635
10 Ga0466699_358612 3300042597 Bacteria 17888
11 Ga0466699_427691 3300042597 Bacteria 4147
12 Ga0466699_428487 3300042597 Bacteria 2366
13 AustNasuHG_c1019521 3300000089 Bacteria 2222
14 JGI24698J34947_10000145 3300002449 Bacteria 26759
15 JGI24698J34947_10001607 3300002449 Bacteria 12014
16 Ga0072940_1002371 3300005200 Bacteria 16555
17 Ga0072941_1063996 3300005201 Unclassified 7271
18 Ga0466698_282037 3300042610 Bacteria 3652
19 Ga0466712_101152 3300042614 Bacteria 19189
20 Ga0466718_059612 3300042617 Bacteria 2616
21 Ga0466718_078818 3300042617 Bacteria 3590
22 Ga0466723_254889 3300042618 Bacteria 9060
23 Ga0123355_10254120 3300009826 Bacteria 2469
24 Ga0123356_10006624 3300010049 Bacteria 11673
25 Ga0123356_10191276 3300010049 Bacteria 2078
26 Ga0466692_090593 3300042591 Unclassified 4005
27 Ga0466694_126938 3300042594 Bacteria 17529
28 Ga0466699_026011 3300042597 Bacteria 21303
29 Ga0466699_175187 3300042597 Unclassified 1167
30 Ga0466699_193385 3300042597 Bacteria 2753
31 Ga0466699_225571 3300042597 Bacteria 1623
32 Ga0466699_307129 3300042597 Bacteria 11186
33 Ga0466699_325728 3300042597 Bacteria 11474
34 JGI24698J34947_10004297 3300002449 Bacteria 7755
35 Ga0072940_1010697 3300005200 Bacteria 3744
36 Ga0072940_1070168 3300005200 Bacteria 2019
37 Ga0466700_230246 3300042600 Bacteria 5418
38 Ga0466720_211375 3300042607 Bacteria 60841
39 Ga0123353_10006753 3300010167 Bacteria 15373
40 Ga0466731_012920 3300042622 Bacteria 154202
41 Ga0466690_033896 3300042590 Bacteria 13751
42 Ga0466699_024134 3300042597 Bacteria 6280
43 Ga0466699_172796 3300042597 Bacteria 31229
44 JGI24695J34938_10004714 3300002450 Bacteria 8825
45 JGI24695J34938_10006132 3300002450 Bacteria 7315
46 Ga0072941_1011779 3300005201 Bacteria 29388
47 Ga0466707_058940 3300042601 Bacteria 3809
48 Ga0466712_262658 3300042614 Bacteria 3147
49 Ga0466718_022853 3300042617 Bacteria 49734
50 Ga0123356_10588006 3300010049 Bacteria 1277
51 Ga0466731_133376 3300042622 Bacteria 3668
52 Ga0466699_083218 3300042597 Bacteria 18587
53 Ga0466699_151419 3300042597 Bacteria 8521
54 AustNasuHG_c1001759 3300000089 Unclassified 7845
55 JGI24698J34947_10009893 3300002449 Bacteria 5229
56 Ga0072940_1004403 3300005200 Bacteria 8215
57 Ga0072940_1033979 3300005200 Bacteria 5806
58 Ga0466719_451329 3300042606 Bacteria 1941
59 Ga0466718_004239 3300042617 Bacteria 5975
60 Ga0466718_060516 3300042617 Bacteria 2589
61 Ga0123353_10017028 3300010167 Bacteria 10656
62 Ga0466708_130237 3300042652 Bacteria 5950
63 Ga0466727_108077 3300042655 Bacteria 1086
64 Ga0466692_096018 3300042591 Bacteria 3268
65 Ga0466699_108959 3300042597 Bacteria 3329
66 AustNasuHG_c1002310 3300000089 Bacteria 6881
67 Ga0466719_093233 3300042606 Bacteria 5776
68 Ga0466720_048472 3300042607 Bacteria 8827
69 Ga0466718_023820 3300042617 Bacteria 37871
70 Ga0466718_082024 3300042617 Bacteria 34669
71 Ga0466723_046372 3300042618 Bacteria 32767
72 Ga0466728_094661 3300042620 Bacteria 12988
73 Ga0123356_10003941 3300010049 Bacteria 15436
74 Ga0466704_247752 3300042643 Bacteria 43747
75 Ga0264413_101799 3300024493 Bacteria 45782
76 Ga0466690_189031 3300042590 Bacteria 1629
77 Ga0466699_020558 3300042597 Bacteria 17249
78 Ga0466699_050425 3300042597 Bacteria 17032
79 Ga0072941_1089216 3300005201 Bacteria 2824
80 Ga0072941_1156817 3300005201 Bacteria 9540
81 Ga0466719_124141 3300042606 Bacteria 12649
82 Ga0466712_271960 3300042614 Bacteria 7096
83 Ga0466723_084946 3300042618 Bacteria 6301
84 Ga0466728_024100 3300042620 Bacteria 13352
85 Ga0466702_061799 3300042635 Bacteria 2551
86 Ga0466703_080698 3300042636 Bacteria 31216
87 Ga0466708_320759 3300042652 Bacteria 3385
88 Ga0466699_013636 3300042597 Bacteria 11010
89 Ga0466699_116673 3300042597 Bacteria 22899
90 JGI24698J34947_10055860 3300002449 Bacteria 1965
91 JGI24698J34947_10111818 3300002449 Bacteria 1204
92 Ga0072940_1011847 3300005200 Bacteria 6605
93 Ga0072941_1022223 3300005201 Bacteria 3665
94 Ga0466733_103879 3300042659 Bacteria 22213
95 Ga0466733_195004 3300042659 Bacteria 33242
96 Ga0466720_233714 3300042607 Bacteria 17306
97 Ga0466715_263516 3300042616 Bacteria 6448
98 Ga0466708_149754 3300042652 Bacteria 4431
99 Ga0264413_116292 3300024493 Bacteria 15643
100 Ga0466699_041571 3300042597 Bacteria 10500
101 Ga0466699_251859 3300042597 Bacteria 5773
102 JGI24695J34938_10000568 3300002450 Bacteria 35544
103 Ga0072941_1063995 3300005201 Bacteria 6367
104 Ga0072941_1191177 3300005201 Bacteria 2608
105 Ga0072941_1420623 3300005201 Bacteria 1262

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2781125683 2781410736 269
2 3300042620 Ga0466728_024100 Ga0466728_024100_1238_2056 272
3 iso_pr_bacteria 2781125643 2781293610 273
4 3300042591 Ga0466692_096018 Ga0466692_096018_1480_2364 279
5 3300042618 Ga0466723_254889 Ga0466723_254889_7727_8644 284
6 3300042652 Ga0466708_320759 Ga0466708_320759_1143_2057 285
7 3300038395 Ga0415639_022188 Ga0415639_022188_9689_10618 286
8 3300010167 Ga0123353_10017028 Ga0123353_100170289 287
9 3300042606 Ga0466719_093233 Ga0466719_093233_3324_4241 287
10 3300042614 Ga0466712_271960 Ga0466712_271960_6109_6975 288
11 3300042597 Ga0466699_193385 Ga0466699_193385_1008_1877 289
12 3300042597 Ga0466699_225571 Ga0466699_225571_632_1540 289
13 3300042597 Ga0466699_325728 Ga0466699_325728_2772_3674 289
14 3300002449 JGI24698J34947_10004297 JGI24698J34947_100042974 292
15 3300042643 Ga0466704_247752 Ga0466704_247752_34109_35026 292
16 3300024493 Ga0264413_116292 Ga0264413_1162927 294
17 3300042655 Ga0466727_108077 Ga0466727_108077_47_1006 295
18 3300042622 Ga0466731_012920 Ga0466731_012920_105561_106457 298
19 3300038395 Ga0415639_016295 Ga0415639_016295_2895_3812 299
20 3300042590 Ga0466690_033896 Ga0466690_033896_7918_8835 299
21 3300042617 Ga0466718_059612 Ga0466718_059612_283_1215 299
22 3300005200 Ga0072940_1010697 Ga0072940_10106971 301
23 3300042617 Ga0466718_032132 Ga0466718_032132_342_1247 301
24 3300010049 Ga0123356_10588006 Ga0123356_105880062 302
25 3300042618 Ga0466723_084946 Ga0466723_084946_1965_2873 302
26 3300002450 JGI24695J34938_10000568 JGI24695J34938_100005688 303
27 3300042622 Ga0466731_317461 Ga0466731_317461_2537_3448 303
28 3300042635 Ga0466702_061799 Ga0466702_061799_1002_1913 303
29 3300005200 Ga0072940_1011847 Ga0072940_10118477 304
30 3300005200 Ga0072940_1070168 Ga0072940_10701682 304
31 3300042614 Ga0466712_226582 Ga0466712_226582_170_1084 304
32 3300042617 Ga0466718_004239 Ga0466718_004239_3623_4537 304
33 3300042617 Ga0466718_078818 Ga0466718_078818_1243_2157 304
34 3300002449 JGI24698J34947_10055860 JGI24698J34947_100558602 305
35 3300042601 Ga0466707_058940 Ga0466707_058940_37_957 306
36 3300042616 Ga0466715_263516 Ga0466715_263516_4275_5282 306
37 3300042659 Ga0466733_103879 Ga0466733_103879_13753_14673 306
38 3300005200 Ga0072940_1002371 Ga0072940_10023713 307
39 3300024493 Ga0264413_101799 Ga0264413_1017991 307
40 3300042597 Ga0466699_083218 Ga0466699_083218_5623_6546 307
41 3300042636 Ga0466703_080698 Ga0466703_080698_14507_15430 307
42 iso_pr_bacteria 2781125660 2781330931 307
43 3300005201 Ga0072941_1022223 Ga0072941_10222232 308
44 3300005201 Ga0072941_1089216 Ga0072941_10892163 308
45 3300010049 Ga0123356_10000125 Ga0123356_1000012533 308
46 3300010049 Ga0123356_10191276 Ga0123356_101912762 308
47 3300042590 Ga0466690_189031 Ga0466690_189031_159_1085 308
48 3300042597 Ga0466699_050425 Ga0466699_050425_7432_8358 308
49 3300042597 Ga0466699_307129 Ga0466699_307129_1651_2577 308
50 3300042615 Ga0466711_307867 Ga0466711_307867_2960_3886 308
51 3300042617 Ga0466718_023820 Ga0466718_023820_27687_28613 308
52 3300042618 Ga0466723_046372 Ga0466723_046372_16930_17856 308
53 3300042659 Ga0466733_195004 Ga0466733_195004_7500_8426 308
54 3300010049 Ga0123356_10006624 Ga0123356_100066244 309
55 3300010167 Ga0123353_10006753 Ga0123353_1000675320 309
56 3300042600 Ga0466700_230246 Ga0466700_230246_4415_5344 309
57 3300042614 Ga0466712_101152 Ga0466712_101152_17029_17958 309
58 3300042614 Ga0466712_262658 Ga0466712_262658_348_1277 309
59 3300042617 Ga0466718_082024 Ga0466718_082024_26774_27703 309
60 3300002449 JGI24698J34947_10000145 JGI24698J34947_1000014521 310
61 3300005201 Ga0072941_1011779 Ga0072941_10117798 310
62 3300005201 Ga0072941_1420623 Ga0072941_14206232 310
63 3300042597 Ga0466699_151419 Ga0466699_151419_3152_4084 310
64 3300042597 Ga0466699_159060 Ga0466699_159060_2817_3749 310
65 3300042617 Ga0466718_060516 Ga0466718_060516_283_1215 310
66 3300042620 Ga0466728_094661 Ga0466728_094661_2903_3835 310
67 3300000089 AustNasuHG_c1001759 AustNasuHG_10017593 311
68 3300009826 Ga0123355_10254120 Ga0123355_102541204 311
69 3300042597 Ga0466699_108959 Ga0466699_108959_2267_3202 311
70 3300042607 Ga0466720_233714 Ga0466720_233714_1280_2215 311
71 3300042652 Ga0466708_130237 Ga0466708_130237_303_1238 311
72 3300002450 JGI24695J34938_10006132 JGI24695J34938_100061325 312
73 3300042594 Ga0466694_126938 Ga0466694_126938_1588_2526 312
74 3300042597 Ga0466699_013636 Ga0466699_013636_1875_2813 312
75 3300042597 Ga0466699_041571 Ga0466699_041571_3633_4571 312
76 iso_pr_bacteria 2772190975 2773723038 312
77 3300000089 AustNasuHG_c1002310 AustNasuHG_10023106 313
78 3300000089 AustNasuHG_c1019521 AustNasuHG_10195212 313
79 3300042607 Ga0466720_211375 Ga0466720_211375_16696_17637 313
80 3300005201 Ga0072941_1063995 Ga0072941_10639953 314
81 3300005201 Ga0072941_1063996 Ga0072941_10639964 314
82 3300042597 Ga0466699_175187 Ga0466699_175187_183_1127 314
83 3300042606 Ga0466719_124141 Ga0466719_124141_9535_10479 314
84 3300042617 Ga0466718_022853 Ga0466718_022853_20957_21901 314
85 3300002450 JGI24695J34938_10004714 JGI24695J34938_100047145 315
86 3300005200 Ga0072940_1033979 Ga0072940_10339796 315
87 3300005201 Ga0072941_1191177 Ga0072941_11911772 315
88 3300042597 Ga0466699_026011 Ga0466699_026011_7348_8295 315
89 3300042607 Ga0466720_048472 Ga0466720_048472_4567_5514 315
90 3300002449 JGI24698J34947_10001607 JGI24698J34947_1000160710 316
91 3300042597 Ga0466699_116673 Ga0466699_116673_7315_8265 316
92 3300042597 Ga0466699_427691 Ga0466699_427691_1577_2527 316
93 3300042635 Ga0466702_379929 Ga0466702_379929_759_1709 316
94 3300005201 Ga0072941_1156817 Ga0072941_11568177 317
95 3300042591 Ga0466692_090593 Ga0466692_090593_1218_2258 317
96 3300042597 Ga0466699_172796 Ga0466699_172796_15258_16211 317
97 3300042597 Ga0466699_251859 Ga0466699_251859_4326_5279 317
98 3300042597 Ga0466699_428487 Ga0466699_428487_42_1019 317
99 3300042610 Ga0466698_282037 Ga0466698_282037_1327_2280 317
100 3300042622 Ga0466731_133376 Ga0466731_133376_528_1481 317
101 3300042652 Ga0466708_149754 Ga0466708_149754_1607_2575 317
102 iso_pr_bacteria 2781125658 2781325950 317
103 3300002449 JGI24698J34947_10009893 JGI24698J34947_100098935 318
104 3300010049 Ga0123356_10003941 Ga0123356_1000394110 318
105 3300042597 Ga0466699_020558 Ga0466699_020558_6139_7095 318
106 3300042597 Ga0466699_024134 Ga0466699_024134_635_1591 318
107 3300042606 Ga0466719_451329 Ga0466719_451329_856_1815 319
108 3300002449 JGI24698J34947_10111818 JGI24698J34947_101118182 321
109 3300005200 Ga0072940_1004403 Ga0072940_100440312 327
110 3300042597 Ga0466699_358612 Ga0466699_358612_12080_13072 330

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00849 PseudoU_synth_2 RNA pseudouridylate synthase 92 258 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.