Protein Family IF05365
Metagenome
Isolate
110
Members
37
Samples
105
Scaffolds
306.68
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_358612|Ga0466699_358612_12080_13072
- Length
- 330 aa
- Sequence
- MPAFNHTVTEILPGDLHCKIRLDCYIAEYLGLLSRSQIKARGLEAKINGKNVKISRTVKGGDFLELSWNEAEPLNLIPENIPLDILYEDRRVVVLNKPQGMVVHPGAGNRRGTLANALYFRRLEQAHPEFDTTFHVEGQRPGIVHRLDKETSGVMIAASDDGALAFLSGQFKARKTKKTYIAIVHGIPKEQKGRIETCIARDPKDRKRFTVAALGKYALTYYSVLKTWQLDAMNNHRYSLVMLRPKTGRTHQLRVHLRYLGHSIIGDPLYGFTDPLFPQASLMLHSRRLAITLPGEQNERVFKAPLPERFTVMIRFLNNAHQGTEAQSGI
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.4%
Kalotermitidae
25.7%
Unclassified
14.3%
Termopsidae
2.9%
Rhinotermitidae
2.9%
Blaberidae
2.9%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 2 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 3 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 4 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 25 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 26 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_226582 | 3300042614 | Bacteria | 5154 |
| 2 | Ga0466711_307867 | 3300042615 | Bacteria | 4809 |
| 3 | Ga0466718_032132 | 3300042617 | Bacteria | 1279 |
| 4 | Ga0123356_10000125 | 3300010049 | Bacteria | 84722 |
| 5 | Ga0466731_317461 | 3300042622 | Bacteria | 4069 |
| 6 | Ga0466702_379929 | 3300042635 | Bacteria | 1757 |
| 7 | Ga0415639_016295 | 3300038395 | Bacteria | 3938 |
| 8 | Ga0415639_022188 | 3300038395 | Bacteria | 15573 |
| 9 | Ga0466699_159060 | 3300042597 | Bacteria | 4635 |
| 10 | Ga0466699_358612 | 3300042597 | Bacteria | 17888 |
| 11 | Ga0466699_427691 | 3300042597 | Bacteria | 4147 |
| 12 | Ga0466699_428487 | 3300042597 | Bacteria | 2366 |
| 13 | AustNasuHG_c1019521 | 3300000089 | Bacteria | 2222 |
| 14 | JGI24698J34947_10000145 | 3300002449 | Bacteria | 26759 |
| 15 | JGI24698J34947_10001607 | 3300002449 | Bacteria | 12014 |
| 16 | Ga0072940_1002371 | 3300005200 | Bacteria | 16555 |
| 17 | Ga0072941_1063996 | 3300005201 | Unclassified | 7271 |
| 18 | Ga0466698_282037 | 3300042610 | Bacteria | 3652 |
| 19 | Ga0466712_101152 | 3300042614 | Bacteria | 19189 |
| 20 | Ga0466718_059612 | 3300042617 | Bacteria | 2616 |
| 21 | Ga0466718_078818 | 3300042617 | Bacteria | 3590 |
| 22 | Ga0466723_254889 | 3300042618 | Bacteria | 9060 |
| 23 | Ga0123355_10254120 | 3300009826 | Bacteria | 2469 |
| 24 | Ga0123356_10006624 | 3300010049 | Bacteria | 11673 |
| 25 | Ga0123356_10191276 | 3300010049 | Bacteria | 2078 |
| 26 | Ga0466692_090593 | 3300042591 | Unclassified | 4005 |
| 27 | Ga0466694_126938 | 3300042594 | Bacteria | 17529 |
| 28 | Ga0466699_026011 | 3300042597 | Bacteria | 21303 |
| 29 | Ga0466699_175187 | 3300042597 | Unclassified | 1167 |
| 30 | Ga0466699_193385 | 3300042597 | Bacteria | 2753 |
| 31 | Ga0466699_225571 | 3300042597 | Bacteria | 1623 |
| 32 | Ga0466699_307129 | 3300042597 | Bacteria | 11186 |
| 33 | Ga0466699_325728 | 3300042597 | Bacteria | 11474 |
| 34 | JGI24698J34947_10004297 | 3300002449 | Bacteria | 7755 |
| 35 | Ga0072940_1010697 | 3300005200 | Bacteria | 3744 |
| 36 | Ga0072940_1070168 | 3300005200 | Bacteria | 2019 |
| 37 | Ga0466700_230246 | 3300042600 | Bacteria | 5418 |
| 38 | Ga0466720_211375 | 3300042607 | Bacteria | 60841 |
| 39 | Ga0123353_10006753 | 3300010167 | Bacteria | 15373 |
| 40 | Ga0466731_012920 | 3300042622 | Bacteria | 154202 |
| 41 | Ga0466690_033896 | 3300042590 | Bacteria | 13751 |
| 42 | Ga0466699_024134 | 3300042597 | Bacteria | 6280 |
| 43 | Ga0466699_172796 | 3300042597 | Bacteria | 31229 |
| 44 | JGI24695J34938_10004714 | 3300002450 | Bacteria | 8825 |
| 45 | JGI24695J34938_10006132 | 3300002450 | Bacteria | 7315 |
| 46 | Ga0072941_1011779 | 3300005201 | Bacteria | 29388 |
| 47 | Ga0466707_058940 | 3300042601 | Bacteria | 3809 |
| 48 | Ga0466712_262658 | 3300042614 | Bacteria | 3147 |
| 49 | Ga0466718_022853 | 3300042617 | Bacteria | 49734 |
| 50 | Ga0123356_10588006 | 3300010049 | Bacteria | 1277 |
| 51 | Ga0466731_133376 | 3300042622 | Bacteria | 3668 |
| 52 | Ga0466699_083218 | 3300042597 | Bacteria | 18587 |
| 53 | Ga0466699_151419 | 3300042597 | Bacteria | 8521 |
| 54 | AustNasuHG_c1001759 | 3300000089 | Unclassified | 7845 |
| 55 | JGI24698J34947_10009893 | 3300002449 | Bacteria | 5229 |
| 56 | Ga0072940_1004403 | 3300005200 | Bacteria | 8215 |
| 57 | Ga0072940_1033979 | 3300005200 | Bacteria | 5806 |
| 58 | Ga0466719_451329 | 3300042606 | Bacteria | 1941 |
| 59 | Ga0466718_004239 | 3300042617 | Bacteria | 5975 |
| 60 | Ga0466718_060516 | 3300042617 | Bacteria | 2589 |
| 61 | Ga0123353_10017028 | 3300010167 | Bacteria | 10656 |
| 62 | Ga0466708_130237 | 3300042652 | Bacteria | 5950 |
| 63 | Ga0466727_108077 | 3300042655 | Bacteria | 1086 |
| 64 | Ga0466692_096018 | 3300042591 | Bacteria | 3268 |
| 65 | Ga0466699_108959 | 3300042597 | Bacteria | 3329 |
| 66 | AustNasuHG_c1002310 | 3300000089 | Bacteria | 6881 |
| 67 | Ga0466719_093233 | 3300042606 | Bacteria | 5776 |
| 68 | Ga0466720_048472 | 3300042607 | Bacteria | 8827 |
| 69 | Ga0466718_023820 | 3300042617 | Bacteria | 37871 |
| 70 | Ga0466718_082024 | 3300042617 | Bacteria | 34669 |
| 71 | Ga0466723_046372 | 3300042618 | Bacteria | 32767 |
| 72 | Ga0466728_094661 | 3300042620 | Bacteria | 12988 |
| 73 | Ga0123356_10003941 | 3300010049 | Bacteria | 15436 |
| 74 | Ga0466704_247752 | 3300042643 | Bacteria | 43747 |
| 75 | Ga0264413_101799 | 3300024493 | Bacteria | 45782 |
| 76 | Ga0466690_189031 | 3300042590 | Bacteria | 1629 |
| 77 | Ga0466699_020558 | 3300042597 | Bacteria | 17249 |
| 78 | Ga0466699_050425 | 3300042597 | Bacteria | 17032 |
| 79 | Ga0072941_1089216 | 3300005201 | Bacteria | 2824 |
| 80 | Ga0072941_1156817 | 3300005201 | Bacteria | 9540 |
| 81 | Ga0466719_124141 | 3300042606 | Bacteria | 12649 |
| 82 | Ga0466712_271960 | 3300042614 | Bacteria | 7096 |
| 83 | Ga0466723_084946 | 3300042618 | Bacteria | 6301 |
| 84 | Ga0466728_024100 | 3300042620 | Bacteria | 13352 |
| 85 | Ga0466702_061799 | 3300042635 | Bacteria | 2551 |
| 86 | Ga0466703_080698 | 3300042636 | Bacteria | 31216 |
| 87 | Ga0466708_320759 | 3300042652 | Bacteria | 3385 |
| 88 | Ga0466699_013636 | 3300042597 | Bacteria | 11010 |
| 89 | Ga0466699_116673 | 3300042597 | Bacteria | 22899 |
| 90 | JGI24698J34947_10055860 | 3300002449 | Bacteria | 1965 |
| 91 | JGI24698J34947_10111818 | 3300002449 | Bacteria | 1204 |
| 92 | Ga0072940_1011847 | 3300005200 | Bacteria | 6605 |
| 93 | Ga0072941_1022223 | 3300005201 | Bacteria | 3665 |
| 94 | Ga0466733_103879 | 3300042659 | Bacteria | 22213 |
| 95 | Ga0466733_195004 | 3300042659 | Bacteria | 33242 |
| 96 | Ga0466720_233714 | 3300042607 | Bacteria | 17306 |
| 97 | Ga0466715_263516 | 3300042616 | Bacteria | 6448 |
| 98 | Ga0466708_149754 | 3300042652 | Bacteria | 4431 |
| 99 | Ga0264413_116292 | 3300024493 | Bacteria | 15643 |
| 100 | Ga0466699_041571 | 3300042597 | Bacteria | 10500 |
| 101 | Ga0466699_251859 | 3300042597 | Bacteria | 5773 |
| 102 | JGI24695J34938_10000568 | 3300002450 | Bacteria | 35544 |
| 103 | Ga0072941_1063995 | 3300005201 | Bacteria | 6367 |
| 104 | Ga0072941_1191177 | 3300005201 | Bacteria | 2608 |
| 105 | Ga0072941_1420623 | 3300005201 | Bacteria | 1262 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2781125683 | 2781410736 | 269 |
| 2 | 3300042620 | Ga0466728_024100 | Ga0466728_024100_1238_2056 | 272 |
| 3 | iso_pr_bacteria | 2781125643 | 2781293610 | 273 |
| 4 | 3300042591 | Ga0466692_096018 | Ga0466692_096018_1480_2364 | 279 |
| 5 | 3300042618 | Ga0466723_254889 | Ga0466723_254889_7727_8644 | 284 |
| 6 | 3300042652 | Ga0466708_320759 | Ga0466708_320759_1143_2057 | 285 |
| 7 | 3300038395 | Ga0415639_022188 | Ga0415639_022188_9689_10618 | 286 |
| 8 | 3300010167 | Ga0123353_10017028 | Ga0123353_100170289 | 287 |
| 9 | 3300042606 | Ga0466719_093233 | Ga0466719_093233_3324_4241 | 287 |
| 10 | 3300042614 | Ga0466712_271960 | Ga0466712_271960_6109_6975 | 288 |
| 11 | 3300042597 | Ga0466699_193385 | Ga0466699_193385_1008_1877 | 289 |
| 12 | 3300042597 | Ga0466699_225571 | Ga0466699_225571_632_1540 | 289 |
| 13 | 3300042597 | Ga0466699_325728 | Ga0466699_325728_2772_3674 | 289 |
| 14 | 3300002449 | JGI24698J34947_10004297 | JGI24698J34947_100042974 | 292 |
| 15 | 3300042643 | Ga0466704_247752 | Ga0466704_247752_34109_35026 | 292 |
| 16 | 3300024493 | Ga0264413_116292 | Ga0264413_1162927 | 294 |
| 17 | 3300042655 | Ga0466727_108077 | Ga0466727_108077_47_1006 | 295 |
| 18 | 3300042622 | Ga0466731_012920 | Ga0466731_012920_105561_106457 | 298 |
| 19 | 3300038395 | Ga0415639_016295 | Ga0415639_016295_2895_3812 | 299 |
| 20 | 3300042590 | Ga0466690_033896 | Ga0466690_033896_7918_8835 | 299 |
| 21 | 3300042617 | Ga0466718_059612 | Ga0466718_059612_283_1215 | 299 |
| 22 | 3300005200 | Ga0072940_1010697 | Ga0072940_10106971 | 301 |
| 23 | 3300042617 | Ga0466718_032132 | Ga0466718_032132_342_1247 | 301 |
| 24 | 3300010049 | Ga0123356_10588006 | Ga0123356_105880062 | 302 |
| 25 | 3300042618 | Ga0466723_084946 | Ga0466723_084946_1965_2873 | 302 |
| 26 | 3300002450 | JGI24695J34938_10000568 | JGI24695J34938_100005688 | 303 |
| 27 | 3300042622 | Ga0466731_317461 | Ga0466731_317461_2537_3448 | 303 |
| 28 | 3300042635 | Ga0466702_061799 | Ga0466702_061799_1002_1913 | 303 |
| 29 | 3300005200 | Ga0072940_1011847 | Ga0072940_10118477 | 304 |
| 30 | 3300005200 | Ga0072940_1070168 | Ga0072940_10701682 | 304 |
| 31 | 3300042614 | Ga0466712_226582 | Ga0466712_226582_170_1084 | 304 |
| 32 | 3300042617 | Ga0466718_004239 | Ga0466718_004239_3623_4537 | 304 |
| 33 | 3300042617 | Ga0466718_078818 | Ga0466718_078818_1243_2157 | 304 |
| 34 | 3300002449 | JGI24698J34947_10055860 | JGI24698J34947_100558602 | 305 |
| 35 | 3300042601 | Ga0466707_058940 | Ga0466707_058940_37_957 | 306 |
| 36 | 3300042616 | Ga0466715_263516 | Ga0466715_263516_4275_5282 | 306 |
| 37 | 3300042659 | Ga0466733_103879 | Ga0466733_103879_13753_14673 | 306 |
| 38 | 3300005200 | Ga0072940_1002371 | Ga0072940_10023713 | 307 |
| 39 | 3300024493 | Ga0264413_101799 | Ga0264413_1017991 | 307 |
| 40 | 3300042597 | Ga0466699_083218 | Ga0466699_083218_5623_6546 | 307 |
| 41 | 3300042636 | Ga0466703_080698 | Ga0466703_080698_14507_15430 | 307 |
| 42 | iso_pr_bacteria | 2781125660 | 2781330931 | 307 |
| 43 | 3300005201 | Ga0072941_1022223 | Ga0072941_10222232 | 308 |
| 44 | 3300005201 | Ga0072941_1089216 | Ga0072941_10892163 | 308 |
| 45 | 3300010049 | Ga0123356_10000125 | Ga0123356_1000012533 | 308 |
| 46 | 3300010049 | Ga0123356_10191276 | Ga0123356_101912762 | 308 |
| 47 | 3300042590 | Ga0466690_189031 | Ga0466690_189031_159_1085 | 308 |
| 48 | 3300042597 | Ga0466699_050425 | Ga0466699_050425_7432_8358 | 308 |
| 49 | 3300042597 | Ga0466699_307129 | Ga0466699_307129_1651_2577 | 308 |
| 50 | 3300042615 | Ga0466711_307867 | Ga0466711_307867_2960_3886 | 308 |
| 51 | 3300042617 | Ga0466718_023820 | Ga0466718_023820_27687_28613 | 308 |
| 52 | 3300042618 | Ga0466723_046372 | Ga0466723_046372_16930_17856 | 308 |
| 53 | 3300042659 | Ga0466733_195004 | Ga0466733_195004_7500_8426 | 308 |
| 54 | 3300010049 | Ga0123356_10006624 | Ga0123356_100066244 | 309 |
| 55 | 3300010167 | Ga0123353_10006753 | Ga0123353_1000675320 | 309 |
| 56 | 3300042600 | Ga0466700_230246 | Ga0466700_230246_4415_5344 | 309 |
| 57 | 3300042614 | Ga0466712_101152 | Ga0466712_101152_17029_17958 | 309 |
| 58 | 3300042614 | Ga0466712_262658 | Ga0466712_262658_348_1277 | 309 |
| 59 | 3300042617 | Ga0466718_082024 | Ga0466718_082024_26774_27703 | 309 |
| 60 | 3300002449 | JGI24698J34947_10000145 | JGI24698J34947_1000014521 | 310 |
| 61 | 3300005201 | Ga0072941_1011779 | Ga0072941_10117798 | 310 |
| 62 | 3300005201 | Ga0072941_1420623 | Ga0072941_14206232 | 310 |
| 63 | 3300042597 | Ga0466699_151419 | Ga0466699_151419_3152_4084 | 310 |
| 64 | 3300042597 | Ga0466699_159060 | Ga0466699_159060_2817_3749 | 310 |
| 65 | 3300042617 | Ga0466718_060516 | Ga0466718_060516_283_1215 | 310 |
| 66 | 3300042620 | Ga0466728_094661 | Ga0466728_094661_2903_3835 | 310 |
| 67 | 3300000089 | AustNasuHG_c1001759 | AustNasuHG_10017593 | 311 |
| 68 | 3300009826 | Ga0123355_10254120 | Ga0123355_102541204 | 311 |
| 69 | 3300042597 | Ga0466699_108959 | Ga0466699_108959_2267_3202 | 311 |
| 70 | 3300042607 | Ga0466720_233714 | Ga0466720_233714_1280_2215 | 311 |
| 71 | 3300042652 | Ga0466708_130237 | Ga0466708_130237_303_1238 | 311 |
| 72 | 3300002450 | JGI24695J34938_10006132 | JGI24695J34938_100061325 | 312 |
| 73 | 3300042594 | Ga0466694_126938 | Ga0466694_126938_1588_2526 | 312 |
| 74 | 3300042597 | Ga0466699_013636 | Ga0466699_013636_1875_2813 | 312 |
| 75 | 3300042597 | Ga0466699_041571 | Ga0466699_041571_3633_4571 | 312 |
| 76 | iso_pr_bacteria | 2772190975 | 2773723038 | 312 |
| 77 | 3300000089 | AustNasuHG_c1002310 | AustNasuHG_10023106 | 313 |
| 78 | 3300000089 | AustNasuHG_c1019521 | AustNasuHG_10195212 | 313 |
| 79 | 3300042607 | Ga0466720_211375 | Ga0466720_211375_16696_17637 | 313 |
| 80 | 3300005201 | Ga0072941_1063995 | Ga0072941_10639953 | 314 |
| 81 | 3300005201 | Ga0072941_1063996 | Ga0072941_10639964 | 314 |
| 82 | 3300042597 | Ga0466699_175187 | Ga0466699_175187_183_1127 | 314 |
| 83 | 3300042606 | Ga0466719_124141 | Ga0466719_124141_9535_10479 | 314 |
| 84 | 3300042617 | Ga0466718_022853 | Ga0466718_022853_20957_21901 | 314 |
| 85 | 3300002450 | JGI24695J34938_10004714 | JGI24695J34938_100047145 | 315 |
| 86 | 3300005200 | Ga0072940_1033979 | Ga0072940_10339796 | 315 |
| 87 | 3300005201 | Ga0072941_1191177 | Ga0072941_11911772 | 315 |
| 88 | 3300042597 | Ga0466699_026011 | Ga0466699_026011_7348_8295 | 315 |
| 89 | 3300042607 | Ga0466720_048472 | Ga0466720_048472_4567_5514 | 315 |
| 90 | 3300002449 | JGI24698J34947_10001607 | JGI24698J34947_1000160710 | 316 |
| 91 | 3300042597 | Ga0466699_116673 | Ga0466699_116673_7315_8265 | 316 |
| 92 | 3300042597 | Ga0466699_427691 | Ga0466699_427691_1577_2527 | 316 |
| 93 | 3300042635 | Ga0466702_379929 | Ga0466702_379929_759_1709 | 316 |
| 94 | 3300005201 | Ga0072941_1156817 | Ga0072941_11568177 | 317 |
| 95 | 3300042591 | Ga0466692_090593 | Ga0466692_090593_1218_2258 | 317 |
| 96 | 3300042597 | Ga0466699_172796 | Ga0466699_172796_15258_16211 | 317 |
| 97 | 3300042597 | Ga0466699_251859 | Ga0466699_251859_4326_5279 | 317 |
| 98 | 3300042597 | Ga0466699_428487 | Ga0466699_428487_42_1019 | 317 |
| 99 | 3300042610 | Ga0466698_282037 | Ga0466698_282037_1327_2280 | 317 |
| 100 | 3300042622 | Ga0466731_133376 | Ga0466731_133376_528_1481 | 317 |
| 101 | 3300042652 | Ga0466708_149754 | Ga0466708_149754_1607_2575 | 317 |
| 102 | iso_pr_bacteria | 2781125658 | 2781325950 | 317 |
| 103 | 3300002449 | JGI24698J34947_10009893 | JGI24698J34947_100098935 | 318 |
| 104 | 3300010049 | Ga0123356_10003941 | Ga0123356_1000394110 | 318 |
| 105 | 3300042597 | Ga0466699_020558 | Ga0466699_020558_6139_7095 | 318 |
| 106 | 3300042597 | Ga0466699_024134 | Ga0466699_024134_635_1591 | 318 |
| 107 | 3300042606 | Ga0466719_451329 | Ga0466719_451329_856_1815 | 319 |
| 108 | 3300002449 | JGI24698J34947_10111818 | JGI24698J34947_101118182 | 321 |
| 109 | 3300005200 | Ga0072940_1004403 | Ga0072940_100440312 | 327 |
| 110 | 3300042597 | Ga0466699_358612 | Ga0466699_358612_12080_13072 | 330 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00849 | PseudoU_synth_2 | RNA pseudouridylate synthase | 92 | 258 | 0.93 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.75 | 0.75 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.