Protein Family IF05349

Metagenome Isolate
113 Members
30 Samples
105 Scaffolds
283.23 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_279086|Ga0466699_279086_16_981
Length
321 aa
Sequence
LQIEVKLISNKSLLEKINVFLKSNKAKPIFSPYIWYTVLEVIPVRKKREFIQGAFYHVTSRTNDKIRVFENKLGRKIMLMVLQDAKEKYRFRLANFCVMPTHIHLLIQPEESTHLSTIMQWIKTHSAKRWNNIHGSSDHLWGHRYFARAVKDPQEYEFIMNYIDQNPVKAGLAPSPAEWRASGAYYKAWDIKGLVDFAPYDRQSYIKLLSPIPPIVSHLLPPAQLAHTLQYYGAYAETIEKLYTLVSTIPELGDTETIQNPPTFLRYFTTMADYFVCEYDGQDTMFGKVRSGIHPAETKYQKFSLHNLKSNPSMRLDFSFR

📊 Sample Types

Isolate 7.1%
Metagenome 92.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 71.4%
Unclassified 28.6%

🌳 Taxonomy

Archaea 0
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
2 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
3 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
4 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
7 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
13 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
14 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
15 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
16 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
17 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
18 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
25 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
26 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466731_171820 3300042622 Bacteria 1164
2 Ga0466712_234544 3300042614 Bacteria 5367
3 Ga0123356_10441268 3300010049 Unclassified 1448
4 Ga0123356_10661776 3300010049 Bacteria 1212
5 Ga0123353_10259767 3300010167 Bacteria 2684
6 Ga0466694_234507 3300042594 Bacteria 1126
7 Ga0466699_289036 3300042597 Bacteria 1421
8 Ga0466699_416859 3300042597 Bacteria 1946
9 Ga0466698_337707 3300042610 Bacteria 1480
10 AustNasuHG_c1042859 3300000089 Bacteria 1071
11 Ga0123353_11146559 3300010167 Bacteria 1026
12 Ga0264413_118805 3300024493 Bacteria 3350
13 Ga0466699_156014 3300042597 Bacteria 2148
14 Ga0466720_129231 3300042607 Bacteria 5752
15 Ga0466720_133637 3300042607 Bacteria 7513
16 Ga0466698_341807 3300042610 Bacteria 1606
17 Ga0466698_458678 3300042610 Bacteria 1774
18 AustNasuHG_c1030791 3300000089 Bacteria 1534
19 JGI24698J34947_10018611 3300002449 Bacteria 3750
20 JGI24698J34947_10068996 3300002449 Bacteria 1707
21 Ga0466712_044909 3300042614 Bacteria 10576
22 Ga0466712_221572 3300042614 Bacteria 1868
23 Ga0466718_013984 3300042617 Bacteria 6504
24 Ga0123356_10406548 3300010049 Bacteria 1500
25 Ga0466694_118866 3300042594 Bacteria 2452
26 Ga0466699_018642 3300042597 Bacteria 1426
27 Ga0466699_121374 3300042597 Bacteria 2827
28 Ga0466717_185743 3300042604 Bacteria 1545
29 Ga0466720_027158 3300042607 Bacteria 7289
30 Ga0466720_047951 3300042607 Bacteria 7294
31 Ga0466720_075859 3300042607 Bacteria 3776
32 JGI24695J34938_10087289 3300002450 Bacteria 1283
33 JGI24702J35022_10006731 3300002462 Bacteria 6624
34 Ga0072940_1010877 3300005200 Bacteria 1646
35 Ga0072941_1108036 3300005201 Bacteria 3386
36 Ga0123356_10184082 3300010049 Bacteria 2113
37 Ga0466721_081037 3300042608 Bacteria 36334
38 JGI24695J34938_10060496 3300002450 Bacteria 1616
39 Ga0466712_287731 3300042614 Bacteria 4424
40 Ga0123356_10000062 3300010049 Bacteria 112695
41 Ga0123353_10891756 3300010167 Bacteria 1212
42 Ga0123353_11081529 3300010167 Bacteria 1067
43 Ga0466694_159453 3300042594 Bacteria 1893
44 Ga0466694_222939 3300042594 Bacteria 2719
45 Ga0466699_016343 3300042597 Bacteria 2084
46 Ga0466699_215295 3300042597 Bacteria 1050
47 Ga0466699_250710 3300042597 Bacteria 2387
48 Ga0466699_356945 3300042597 Bacteria 2272
49 Ga0466699_397094 3300042597 Bacteria 1675
50 Ga0072941_1008823 3300005201 Bacteria 1389
51 Ga0072941_1032998 3300005201 Bacteria 3691
52 Ga0072941_1046617 3300005201 Bacteria 4249
53 Ga0072941_1197611 3300005201 Bacteria 1321
54 Ga0466702_215882 3300042635 Bacteria 1566
55 Ga0123353_10921442 3300010167 Bacteria 1186
56 Ga0264413_121794 3300024493 Bacteria 1343
57 Ga0264413_150970 3300024493 Bacteria 1183
58 Ga0466694_365048 3300042594 Bacteria 1140
59 Ga0466699_178522 3300042597 Bacteria 8748
60 Ga0466699_279086 3300042597 Bacteria 1105
61 Ga0466699_349116 3300042597 Bacteria 1392
62 Ga0466699_384804 3300042597 Bacteria 1235
63 Ga0466699_428648 3300042597 Bacteria 1711
64 Ga0466720_109697 3300042607 Bacteria 6947
65 Ga0466720_237262 3300042607 Bacteria 2640
66 Ga0466698_150868 3300042610 Bacteria 1314
67 AustNasuHG_c1007099 3300000089 Bacteria 3989
68 AustNasuHG_c1041827 3300000089 Bacteria 1099
69 JGI24698J34947_10023155 3300002449 Bacteria 3323
70 Ga0466732_230577 3300042656 Bacteria 2694
71 Ga0466712_106189 3300042614 Bacteria 4115
72 Ga0466718_080895 3300042617 Bacteria 3505
73 Ga0123356_10000120 3300010049 Bacteria 85763
74 Ga0123356_10002920 3300010049 Bacteria 18099
75 Ga0123356_10191552 3300010049 Bacteria 2076
76 Ga0264413_118877 3300024493 Bacteria 2746
77 Ga0466699_021552 3300042597 Bacteria 16840
78 Ga0466699_057157 3300042597 Bacteria 2319
79 Ga0466720_021934 3300042607 Bacteria 78212
80 Ga0466720_166520 3300042607 Bacteria 2824
81 AustNasuHG_c1017929 3300000089 Bacteria 2343
82 AustNasuHG_c1029514 3300000089 Bacteria 1603
83 JGI24695J34938_10002833 3300002450 Bacteria 12670
84 JGI24695J34938_10023527 3300002450 Bacteria 2968
85 JGI24702J35022_10198804 3300002462 Bacteria 1146
86 Ga0072941_1040763 3300005201 Bacteria 1380
87 Ga0072941_1112783 3300005201 Bacteria 1271
88 Ga0466732_116630 3300042656 Bacteria 1954
89 Ga0466702_315981 3300042635 Bacteria 1188
90 Ga0466712_097818 3300042614 Bacteria 14218
91 Ga0466718_086776 3300042617 Bacteria 73105
92 Ga0123355_10145669 3300009826 Bacteria 3612
93 Ga0123356_10000432 3300010049 Bacteria 47836
94 Ga0415639_142077 3300038395 Bacteria 995
95 Ga0466699_032890 3300042597 Bacteria 1954
96 Ga0466699_418735 3300042597 Bacteria 4056
97 Ga0466720_040900 3300042607 Bacteria 18087
98 Ga0466720_041178 3300042607 Bacteria 2549
99 Ga0466720_061959 3300042607 Bacteria 9848
100 JGI24698J34947_10011458 3300002449 Bacteria 4869
101 JGI24695J34938_10001710 3300002450 Bacteria 18145
102 JGI24695J34938_10034111 3300002450 Bacteria 2336
103 Ga0072941_1017058 3300005201 Bacteria 18391
104 Ga0072941_1077255 3300005201 Bacteria 1044
105 Ga0072941_1244967 3300005201 Bacteria 2074

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10441268 Ga0123356_104412682 231
2 3300010167 Ga0123353_11146559 Ga0123353_111465592 242
3 3300042597 Ga0466699_356945 Ga0466699_356945_1037_1774 245
4 3300000089 AustNasuHG_c1029514 AustNasuHG_10295142 265
5 3300042610 Ga0466698_458678 Ga0466698_458678_157_954 265
6 3300024493 Ga0264413_121794 Ga0264413_1217941 267
7 3300002450 JGI24695J34938_10023527 JGI24695J34938_100235271 268
8 3300042594 Ga0466694_234507 Ga0466694_234507_240_1058 272
9 3300042597 Ga0466699_021552 Ga0466699_021552_11994_12818 274
10 3300042607 Ga0466720_109697 Ga0466720_109697_5313_6137 274
11 3300042597 Ga0466699_215295 Ga0466699_215295_156_983 275
12 3300042597 Ga0466699_349116 Ga0466699_349116_330_1157 275
13 iso_pr_bacteria 2781125641 2781290643 275
14 3300002450 JGI24695J34938_10060496 JGI24695J34938_100604962 276
15 3300005201 Ga0072941_1197611 Ga0072941_11976111 276
16 3300010049 Ga0123356_10191552 Ga0123356_101915521 276
17 3300010167 Ga0123353_10259767 Ga0123353_102597672 276
18 3300042594 Ga0466694_118866 Ga0466694_118866_1211_2041 276
19 3300042594 Ga0466694_159453 Ga0466694_159453_506_1336 276
20 3300042597 Ga0466699_121374 Ga0466699_121374_906_1736 276
21 3300000089 AustNasuHG_c1030791 AustNasuHG_10307912 277
22 3300000089 AustNasuHG_c1042859 AustNasuHG_10428591 277
23 3300005201 Ga0072941_1032998 Ga0072941_10329984 277
24 3300042597 Ga0466699_016343 Ga0466699_016343_266_1099 277
25 3300042597 Ga0466699_032890 Ga0466699_032890_705_1538 277
26 3300042597 Ga0466699_178522 Ga0466699_178522_6883_7716 277
27 3300042597 Ga0466699_428648 Ga0466699_428648_203_1036 277
28 3300042610 Ga0466698_150868 Ga0466698_150868_114_947 277
29 3300042610 Ga0466698_341807 Ga0466698_341807_220_1053 277
30 3300042656 Ga0466732_116630 Ga0466732_116630_146_979 277
31 3300042597 Ga0466699_018642 Ga0466699_018642_132_968 278
32 3300042597 Ga0466699_384804 Ga0466699_384804_274_1110 278
33 3300042597 Ga0466699_416859 Ga0466699_416859_722_1558 278
34 3300042597 Ga0466699_418735 Ga0466699_418735_829_1665 278
35 3300042607 Ga0466720_129231 Ga0466720_129231_4445_5281 278
36 iso_pr_bacteria 2781125660 2781330312 278
37 3300000089 AustNasuHG_c1017929 AustNasuHG_10179292 279
38 3300005201 Ga0072941_1077255 Ga0072941_10772551 279
39 3300005201 Ga0072941_1244967 Ga0072941_12449671 279
40 3300010049 Ga0123356_10000062 Ga0123356_10000062105 279
41 3300024493 Ga0264413_150970 Ga0264413_1509701 279
42 3300042594 Ga0466694_222939 Ga0466694_222939_703_1542 279
43 3300042607 Ga0466720_040900 Ga0466720_040900_13252_14091 279
44 3300042635 Ga0466702_215882 Ga0466702_215882_117_956 279
45 3300042607 Ga0466720_166520 Ga0466720_166520_1567_2409 280
46 3300042614 Ga0466712_097818 Ga0466712_097818_11549_12391 280
47 iso_pr_bacteria 2781125656 2781321884 280
48 3300002449 JGI24698J34947_10068996 JGI24698J34947_100689962 281
49 3300009826 Ga0123355_10145669 Ga0123355_101456695 281
50 3300002450 JGI24695J34938_10002833 JGI24695J34938_100028336 282
51 3300005201 Ga0072941_1008823 Ga0072941_10088231 282
52 3300042607 Ga0466720_041178 Ga0466720_041178_921_1769 282
53 3300042607 Ga0466720_133637 Ga0466720_133637_2374_3222 282
54 3300042614 Ga0466712_221572 Ga0466712_221572_773_1621 282
55 3300000089 AustNasuHG_c1007099 AustNasuHG_10070992 283
56 3300042597 Ga0466699_289036 Ga0466699_289036_268_1119 283
57 3300042607 Ga0466720_075859 Ga0466720_075859_467_1318 283
58 3300002462 JGI24702J35022_10006731 JGI24702J35022_100067312 284
59 3300005201 Ga0072941_1040763 Ga0072941_10407631 284
60 3300042594 Ga0466694_365048 Ga0466694_365048_202_1056 284
61 3300042597 Ga0466699_250710 Ga0466699_250710_112_966 284
62 3300042607 Ga0466720_021934 Ga0466720_021934_12650_13504 284
63 3300042607 Ga0466720_061959 Ga0466720_061959_4143_4997 284
64 3300042608 Ga0466721_081037 Ga0466721_081037_22371_23225 284
65 3300042614 Ga0466712_044909 Ga0466712_044909_2528_3382 284
66 3300042635 Ga0466702_315981 Ga0466702_315981_126_980 284
67 iso_pr_bacteria 2781125665 2781341036 284
68 3300002449 JGI24698J34947_10018611 JGI24698J34947_100186113 285
69 3300002450 JGI24695J34938_10034111 JGI24695J34938_100341112 285
70 3300010049 Ga0123356_10000120 Ga0123356_100001203 285
71 3300010049 Ga0123356_10406548 Ga0123356_104065481 285
72 3300010167 Ga0123353_10891756 Ga0123353_108917561 285
73 3300024493 Ga0264413_118805 Ga0264413_1188053 285
74 3300042614 Ga0466712_106189 Ga0466712_106189_2241_3098 285
75 3300042656 Ga0466732_230577 Ga0466732_230577_367_1224 285
76 iso_pr_bacteria 2781125652 2781311712 285
77 3300002449 JGI24698J34947_10011458 JGI24698J34947_100114583 286
78 3300002450 JGI24695J34938_10087289 JGI24695J34938_100872892 286
79 3300024493 Ga0264413_118877 Ga0264413_1188773 286
80 3300038395 Ga0415639_142077 Ga0415639_142077_123_983 286
81 3300042617 Ga0466718_013984 Ga0466718_013984_3828_4688 286
82 3300042617 Ga0466718_080895 Ga0466718_080895_2185_3045 286
83 3300042617 Ga0466718_086776 Ga0466718_086776_3332_4192 286
84 iso_pr_bacteria 2781125662 2781336257 286
85 iso_pr_bacteria 2781125664 2781339531 286
86 3300000089 AustNasuHG_c1041827 AustNasuHG_10418271 287
87 3300010049 Ga0123356_10000432 Ga0123356_1000043235 287
88 3300042597 Ga0466699_057157 Ga0466699_057157_599_1462 287
89 3300042607 Ga0466720_237262 Ga0466720_237262_585_1448 287
90 3300002449 JGI24698J34947_10023155 JGI24698J34947_100231553 288
91 3300005201 Ga0072941_1112783 Ga0072941_11127832 288
92 3300042607 Ga0466720_047951 Ga0466720_047951_3280_4146 288
93 3300005200 Ga0072940_1010877 Ga0072940_10108772 289
94 3300005201 Ga0072941_1046617 Ga0072941_10466173 289
95 3300042604 Ga0466717_185743 Ga0466717_185743_242_1111 289
96 3300042614 Ga0466712_234544 Ga0466712_234544_3290_4159 289
97 3300005201 Ga0072941_1017058 Ga0072941_101705816 290
98 3300042607 Ga0466720_027158 Ga0466720_027158_2403_3284 293
99 3300002462 JGI24702J35022_10198804 JGI24702J35022_101988041 294
100 3300002450 JGI24695J34938_10001710 JGI24695J34938_100017102 297
101 3300005201 Ga0072941_1108036 Ga0072941_11080362 297
102 3300010049 Ga0123356_10661776 Ga0123356_106617761 297
103 3300010167 Ga0123353_11081529 Ga0123353_110815292 297
104 iso_pr_bacteria 2781125629 2781264179 299
105 3300010049 Ga0123356_10002920 Ga0123356_100029202 301
106 3300042622 Ga0466731_171820 Ga0466731_171820_180_1088 302
107 3300010049 Ga0123356_10184082 Ga0123356_101840823 310
108 3300010167 Ga0123353_10921442 Ga0123353_109214422 310
109 3300042597 Ga0466699_156014 Ga0466699_156014_217_1155 312
110 3300042597 Ga0466699_397094 Ga0466699_397094_402_1346 314
111 3300042610 Ga0466698_337707 Ga0466698_337707_80_1024 314
112 3300042614 Ga0466712_287731 Ga0466712_287731_1448_2407 319
113 3300042597 Ga0466699_279086 Ga0466699_279086_16_981 321

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01797 Y1_Tnp Transposase IS200 like 55 166 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.