Protein Family IF05348

Metagenome Isolate
110 Members
42 Samples
104 Scaffolds
404.88 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_277343|Ga0466699_277343_430_1788
Length
452 aa
Sequence
MPELINSDIPFARPFIGEAEEAAVLRVLRSGWLTTGVEALALEKEFAQFLQKDLSPSTDNIHCLAVNSATSGLHLALEACGVGQGDVILVPSCTFTATAEVARYLGADPVFVDVSPGTFHIDPNALEETILRLRPKKPKAVIPVHYGGLPCDMGAILAIAKRYGLKVIEDAAHAFPSLMGSGDQGLGTREKRGTRVRGSGIGDCYSNYNSASELQSDTSNNDPQSLIPSPQSPFFAGTVGDIGVFSFYATKTITTGEGGMIVCCDETMAKRISVMRSHGIDRAVWNRYSDTRASWYYEVVEAGYKYNLPDILAAIGRVQLSRAWELLQMRKEIAAAYDLAFGGMACFQLPPTGPADARHLYPLRLDPQRLNISRDAFIQKLQEAGIGTSVHFIPLHIMPFYRNRYHLAEYDFPETMKSCKQEISLPIWPGMGKDQINKVIEVVQSIANSYTV

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.1%
Kalotermitidae 31.7%
Unclassified 17.1%
Rhinotermitidae 9.8%
Termopsidae 4.9%
Blaberidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 103
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
10 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
11 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
12 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
15 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
26 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
27 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 2772190975 Treponema sp. RmG30 Isolate Blaberidae
42 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_227615 3300042612 Bacteria 6136
2 Ga0072941_1027594 3300005201 Bacteria 10761
3 Ga0466700_434566 3300042600 Bacteria 4327
4 Ga0466722_078639 3300042609 Bacteria 8990
5 Ga0466722_133396 3300042609 Bacteria 7018
6 Ga0466722_241852 3300042609 Bacteria 3095
7 Ga0466704_317389 3300042643 Bacteria 7418
8 Ga0466711_119725 3300042615 Bacteria 5542
9 Ga0466726_271676 3300042619 Bacteria 3572
10 Ga0466694_403400 3300042594 Bacteria 17229
11 Ga0466699_271874 3300042597 Bacteria 2155
12 Ga0466699_277343 3300042597 Bacteria 6536
13 Ga0123354_10060467 3300010882 Bacteria 5602
14 Ga0072941_1000022 3300005201 Bacteria 6630
15 Ga0466716_362076 3300042605 Bacteria 22472
16 Ga0466722_084381 3300042609 Bacteria 43243
17 Ga0466703_107884 3300042636 Bacteria 2612
18 Ga0466704_114743 3300042643 Bacteria 17844
19 Ga0466709_082466 3300042648 Bacteria 1670
20 Ga0466709_314082 3300042648 Bacteria 9689
21 Ga0466723_307612 3300042618 Bacteria 2536
22 Ga0466692_163898 3300042591 Bacteria 25340
23 Ga0466699_090069 3300042597 Bacteria 12185
24 Ga0466699_125929 3300042597 Bacteria 23582
25 Ga0466699_137732 3300042597 Bacteria 8756
26 Ga0466699_185650 3300042597 Bacteria 28129
27 Ga0466705_051637 3300042612 Bacteria 9140
28 Ga0466705_161863 3300042612 Bacteria 9292
29 Ga0123355_10253889 3300009826 Bacteria 2470
30 JGI24698J34947_10037384 3300002449 Bacteria 2522
31 Ga0466700_214133 3300042600 Bacteria 2791
32 Ga0466720_190868 3300042607 Bacteria 1922
33 Ga0466704_450436 3300042643 Unclassified 12474
34 Ga0466705_481576 3300042612 Bacteria 4482
35 Ga0466712_045877 3300042614 Bacteria 18411
36 Ga0466726_049108 3300042619 Bacteria 43705
37 Ga0466693_347585 3300042592 Unclassified 5286
38 Ga0466691_166820 3300042593 Bacteria 3701
39 Ga0466699_071239 3300042597 Bacteria 1919
40 Ga0466699_075565 3300042597 Bacteria 1328
41 Ga0466699_093121 3300042597 Bacteria 25575
42 Ga0466699_335399 3300042597 Unclassified 1050
43 Ga0123353_10274682 3300010167 Bacteria 2593
44 Ga0072941_1022677 3300005201 Bacteria 18258
45 Ga0466701_090223 3300042598 Bacteria 2267
46 Ga0466703_293153 3300042636 Bacteria 14467
47 Ga0466704_347464 3300042643 Bacteria 7730
48 Ga0466704_504100 3300042643 Bacteria 25621
49 Ga0466712_006108 3300042614 Bacteria 13031
50 Ga0466712_023563 3300042614 Bacteria 2279
51 Ga0466723_041142 3300042618 Bacteria 41550
52 Ga0466694_361477 3300042594 Bacteria 13266
53 Ga0466699_159040 3300042597 Bacteria 2433
54 Ga0466699_275704 3300042597 Bacteria 2302
55 Ga0466699_305827 3300042597 Bacteria 1928
56 Ga0466705_030257 3300042612 Bacteria 8961
57 AustNasuHG_c1009755 3300000089 Bacteria 3362
58 JGI24698J34947_10022667 3300002449 Bacteria 3364
59 JGI24698J34947_10031789 3300002449 Bacteria 2775
60 Ga0072941_1029669 3300005201 Bacteria 8282
61 Ga0466707_144403 3300042601 Bacteria 1093
62 Ga0466729_220189 3300042621 Bacteria 3746
63 Ga0466703_013060 3300042636 Bacteria 5166
64 Ga0466704_006319 3300042643 Bacteria 7188
65 Ga0466727_055424 3300042655 Bacteria 3145
66 Ga0466712_022875 3300042614 Bacteria 13515
67 Ga0466712_187892 3300042614 Bacteria 4663
68 Ga0466712_227422 3300042614 Bacteria 3970
69 Ga0466718_025634 3300042617 Bacteria 20527
70 Ga0466692_173038 3300042591 Bacteria 6368
71 Ga0466699_102598 3300042597 Bacteria 1351
72 Ga0466699_229850 3300042597 Bacteria 35684
73 Ga0466713_033452 3300042602 Bacteria 3322
74 Ga0466716_169261 3300042605 Unclassified 2271
75 Ga0466719_370505 3300042606 Bacteria 17953
76 Ga0466704_072937 3300042643 Bacteria 17972
77 Ga0466708_098468 3300042652 Bacteria 6187
78 Ga0466712_253361 3300042614 Bacteria 30767
79 Ga0466699_047707 3300042597 Bacteria 8382
80 Ga0466699_070553 3300042597 Bacteria 13941
81 Ga0466705_171803 3300042612 Bacteria 8786
82 JGI24698J34947_10009316 3300002449 Unclassified 5391
83 Ga0072941_1076976 3300005201 Unclassified 2373
84 Ga0466720_018934 3300042607 Bacteria 104216
85 Ga0466720_174843 3300042607 Bacteria 13899
86 Ga0466703_082213 3300042636 Bacteria 3730
87 Ga0466703_353855 3300042636 Bacteria 7791
88 Ga0466708_120563 3300042652 Bacteria 4982
89 Ga0466712_118669 3300042614 Bacteria 1831
90 Ga0466690_167416 3300042590 Bacteria 5323
91 Ga0466694_189320 3300042594 Bacteria 39847
92 Ga0466732_423191 3300042656 Bacteria 5265
93 Ga0123355_10223709 3300009826 Bacteria 2701
94 JGI24698J34947_10029166 3300002449 Bacteria 2917
95 Ga0466722_222675 3300042609 Bacteria 6020
96 Ga0466704_536551 3300042643 Bacteria 6622
97 Ga0466727_280882 3300042655 Bacteria 2958
98 Ga0466712_038130 3300042614 Bacteria 20446
99 Ga0466712_247749 3300042614 Unclassified 3797
100 Ga0466715_427821 3300042616 Bacteria 8349
101 Ga0456237_0001631 3300041968 Bacteria 3592
102 Ga0466692_046426 3300042591 Bacteria 2517
103 Ga0466694_013479 3300042594 Bacteria 2930
104 Ga0466696_019725 3300042596 Bacteria 19619

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_335399 Ga0466699_335399_17_1033 324
2 3300042601 Ga0466707_144403 Ga0466707_144403_26_1069 347
3 3300042609 Ga0466722_078639 Ga0466722_078639_5042_6199 385
4 3300005201 Ga0072941_1022677 Ga0072941_10226772 387
5 3300042597 Ga0466699_125929 Ga0466699_125929_6393_7559 388
6 3300042597 Ga0466699_137732 Ga0466699_137732_7289_8455 388
7 3300042614 Ga0466712_045877 Ga0466712_045877_9122_10288 388
8 3300042609 Ga0466722_084381 Ga0466722_084381_10242_11414 390
9 3300005201 Ga0072941_1029669 Ga0072941_102966912 391
10 3300005201 Ga0072941_1076976 Ga0072941_10769762 391
11 3300042648 Ga0466709_082466 Ga0466709_082466_273_1448 391
12 3300042652 Ga0466708_120563 Ga0466708_120563_1954_3129 391
13 3300002449 JGI24698J34947_10031789 JGI24698J34947_100317892 392
14 3300042597 Ga0466699_090069 Ga0466699_090069_6978_8156 392
15 3300042614 Ga0466712_253361 Ga0466712_253361_21477_22655 392
16 3300002449 JGI24698J34947_10029166 JGI24698J34947_100291662 393
17 3300002449 JGI24698J34947_10037384 JGI24698J34947_100373843 393
18 3300042594 Ga0466694_361477 Ga0466694_361477_6215_7396 393
19 3300042600 Ga0466700_214133 Ga0466700_214133_891_2072 393
20 3300042605 Ga0466716_169261 Ga0466716_169261_634_1815 393
21 3300042607 Ga0466720_174843 Ga0466720_174843_7548_8729 393
22 3300042609 Ga0466722_241852 Ga0466722_241852_580_1761 393
23 3300042617 Ga0466718_025634 Ga0466718_025634_16777_17958 393
24 3300042648 Ga0466709_314082 Ga0466709_314082_5874_7055 393
25 3300042607 Ga0466720_018934 Ga0466720_018934_758_1942 394
26 3300042592 Ga0466693_347585 Ga0466693_347585_3659_4846 395
27 3300042597 Ga0466699_047707 Ga0466699_047707_5794_6981 395
28 3300042597 Ga0466699_071239 Ga0466699_071239_233_1420 395
29 3300042597 Ga0466699_185650 Ga0466699_185650_6923_8110 395
30 3300042594 Ga0466694_013479 Ga0466694_013479_324_1514 396
31 iso_pr_bacteria 2781125685 2781417233 396
32 3300042602 Ga0466713_033452 Ga0466713_033452_1106_2299 397
33 3300042616 Ga0466715_427821 Ga0466715_427821_636_1829 397
34 3300041968 Ga0456237_0001631 Ga0456237_0001631_1228_2424 398
35 3300042597 Ga0466699_075565 Ga0466699_075565_64_1260 398
36 3300042597 Ga0466699_102598 Ga0466699_102598_33_1229 398
37 3300042609 Ga0466722_133396 Ga0466722_133396_5357_6553 398
38 3300042614 Ga0466712_006108 Ga0466712_006108_1100_2296 398
39 3300042652 Ga0466708_098468 Ga0466708_098468_2106_3302 398
40 3300009826 Ga0123355_10223709 Ga0123355_102237092 399
41 3300042591 Ga0466692_046426 Ga0466692_046426_1064_2263 399
42 3300042597 Ga0466699_229850 Ga0466699_229850_28343_29542 399
43 3300042636 Ga0466703_082213 Ga0466703_082213_1491_2690 399
44 3300042656 Ga0466732_423191 Ga0466732_423191_3808_5007 399
45 3300010882 Ga0123354_10060467 Ga0123354_100604672 400
46 3300042605 Ga0466716_362076 Ga0466716_362076_14680_15882 400
47 3300042606 Ga0466719_370505 Ga0466719_370505_13140_14342 400
48 3300042596 Ga0466696_019725 Ga0466696_019725_15594_16799 401
49 3300042607 Ga0466720_190868 Ga0466720_190868_149_1354 401
50 3300042636 Ga0466703_353855 Ga0466703_353855_2741_3946 401
51 iso_pr_bacteria 2781125682 2781409530 401
52 3300042590 Ga0466690_167416 Ga0466690_167416_2022_3230 402
53 3300042591 Ga0466692_163898 Ga0466692_163898_9863_11071 402
54 3300042591 Ga0466692_173038 Ga0466692_173038_1768_2976 402
55 3300042593 Ga0466691_166820 Ga0466691_166820_2239_3447 402
56 3300042597 Ga0466699_070553 Ga0466699_070553_727_1938 403
57 3300005201 Ga0072941_1027594 Ga0072941_10275943 404
58 3300042594 Ga0466694_403400 Ga0466694_403400_4774_5988 404
59 3300042600 Ga0466700_434566 Ga0466700_434566_79_1293 404
60 3300042612 Ga0466705_030257 Ga0466705_030257_3766_4998 404
61 3300042614 Ga0466712_023563 Ga0466712_023563_188_1402 404
62 3300042614 Ga0466712_247749 Ga0466712_247749_965_2230 405
63 3300042636 Ga0466703_293153 Ga0466703_293153_3472_4689 405
64 3300042643 Ga0466704_450436 Ga0466704_450436_5662_6879 405
65 3300042612 Ga0466705_051637 Ga0466705_051637_1380_2600 406
66 3300042614 Ga0466712_187892 Ga0466712_187892_2605_3825 406
67 3300042636 Ga0466703_107884 Ga0466703_107884_438_1658 406
68 iso_pr_bacteria 2781125693 2781433622 406
69 3300000089 AustNasuHG_c1009755 AustNasuHG_10097552 407
70 3300042612 Ga0466705_481576 Ga0466705_481576_1005_2228 407
71 3300042643 Ga0466704_317389 Ga0466704_317389_4668_5891 407
72 3300042643 Ga0466704_536551 Ga0466704_536551_3154_4377 407
73 3300009826 Ga0123355_10253889 Ga0123355_102538892 408
74 3300042618 Ga0466723_307612 Ga0466723_307612_841_2136 408
75 3300042614 Ga0466712_038130 Ga0466712_038130_8981_10264 409
76 3300042597 Ga0466699_271874 Ga0466699_271874_544_1779 411
77 3300042598 Ga0466701_090223 Ga0466701_090223_622_1857 411
78 3300042643 Ga0466704_006319 Ga0466704_006319_5352_6611 411
79 3300042643 Ga0466704_347464 Ga0466704_347464_4519_5757 412
80 iso_pr_bacteria 2781125683 2781411050 412
81 3300042597 Ga0466699_159040 Ga0466699_159040_389_1711 413
82 3300042636 Ga0466703_013060 Ga0466703_013060_1505_2746 413
83 3300042615 Ga0466711_119725 Ga0466711_119725_3592_4836 414
84 iso_pr_bacteria 2781125687 2781420549 414
85 3300042597 Ga0466699_275704 Ga0466699_275704_351_1598 415
86 3300042612 Ga0466705_161863 Ga0466705_161863_1588_2844 418
87 3300042643 Ga0466704_114743 Ga0466704_114743_12237_13493 418
88 3300042609 Ga0466722_222675 Ga0466722_222675_4422_5681 419
89 3300042614 Ga0466712_227422 Ga0466712_227422_643_1902 419
90 3300042612 Ga0466705_171803 Ga0466705_171803_3467_4729 420
91 iso_pr_bacteria 2772190975 2773723021 420
92 3300042597 Ga0466699_305827 Ga0466699_305827_158_1423 421
93 3300042618 Ga0466723_041142 Ga0466723_041142_29832_31106 424
94 3300042643 Ga0466704_504100 Ga0466704_504100_5608_6882 424
95 3300042655 Ga0466727_055424 Ga0466727_055424_567_1841 424
96 3300042594 Ga0466694_189320 Ga0466694_189320_6996_8423 425
97 3300042612 Ga0466705_227615 Ga0466705_227615_3936_5216 426
98 3300042619 Ga0466726_049108 Ga0466726_049108_25438_26718 426
99 3300042621 Ga0466729_220189 Ga0466729_220189_493_1836 426
100 3300042643 Ga0466704_072937 Ga0466704_072937_12648_13949 426
101 3300042655 Ga0466727_280882 Ga0466727_280882_1413_2693 426
102 3300010167 Ga0123353_10274682 Ga0123353_102746821 428
103 3300042597 Ga0466699_093121 Ga0466699_093121_6181_7467 428
104 3300005201 Ga0072941_1000022 Ga0072941_10000222 429
105 3300042619 Ga0466726_271676 Ga0466726_271676_34_1326 430
106 3300042614 Ga0466712_118669 Ga0466712_118669_208_1509 433
107 3300002449 JGI24698J34947_10022667 JGI24698J34947_100226671 434
108 3300042614 Ga0466712_022875 Ga0466712_022875_11154_12461 435
109 3300002449 JGI24698J34947_10009316 JGI24698J34947_100093165 436
110 3300042597 Ga0466699_277343 Ga0466699_277343_430_1788 452

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family 236 443 0.95
PF00155 Aminotran_1_2 Aminotransferase class I and II 39 141 0.87

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
4oca-assembly1.cif.gz_A-2 Cryatal structure of ArnB K188A complexted with PLP and UDP-Ara4N 0.949 6 446
1mdo-assembly1.cif.gz_A Crystal structure of ArnB aminotransferase with pyridomine 5' phosphate 0.948 7 447
5uid-assembly2.cif.gz_C The crystal structure of an aminotransferase TlmJ from Streptoalloteichus hindustanus 0.938 7 449
5uid-assembly2.cif.gz_D The crystal structure of an aminotransferase TlmJ from Streptoalloteichus hindustanus 0.936 9 449
7b0m-assembly1.cif.gz_AAA-2 Sugar transaminase from a metagenome collected from troll oil field production water 0.936 8 448
IDDescriptionScoreStartEndSuperfamily
af_Q58466_257_386_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9612 328 450 3.90.1150.10
af_Q58466_2_255_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9516 6 321 3.40.640.10
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9262 9 321 3.40.640.10
4lc3B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9212 6 321 3.40.640.10
5u1zA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9012 20 321 3.40.640.10
IDDescriptionScoreStartEndGO Terms
AF-A0A2M8B5I7-F1-model_v4 Uncharacterized/unreviewed 0.9759 304 447
AF-A0A1F7JD39-F1-model_v4 Uncharacterized/unreviewed 0.957 6 452 GO:0030170
GO:0008483
GO:0000271

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.