Protein Family IF05313

Metagenome Isolate
126 Members
38 Samples
118 Scaffolds
427.32 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_164412|Ga0466699_164412_423_1814
Length
463 aa
Sequence
LGKRQKNFRGTGAAAMSVQKTAGVSAKWIWFVDARYIFRKEKKSPSPVFSLLGIATGVFALIVIIAVMNGFQLGFIESILEISSYHIRIGNLPAGQISQEKIDEASAALLAVPGITAVVPFHEFQGLLRGRRGGQQAVLVRGLPSNALDLDRALAGRLEFEYGDFYFNGGDSVLLGAELAGRMGARIGDEINLFSIESVFFVFYSAEAGMRVFTVGGIFRTGFYEYDMGWAVIGINRAEAFCETGPVLGLKIKNRFHDRQMLELARNSLAVIAGFETAEFTSWRDYNRSFFGALRTEKLFMFILVGLIFIVVGLNIYQSQRRAVLEHREEIGLLRAVGGGERAVRLIFVCDGAIIGFTGALAGLIPGLLIASNIGTFFTVLEKIANFFINIVNFIAGFFGAAGTGNFSFFSPTVFYIKEIPSRVIPEEVLLIFMFGFLSALTAAWFASRKVSQIQPAEVLRYE

📊 Sample Types

Isolate 6.3%
Metagenome 93.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.2%
Unclassified 25.0%
Kalotermitidae 13.9%
Termopsidae 5.6%
Rhinotermitidae 5.6%
Hodotermitidae 2.8%

🌳 Taxonomy

Archaea 1
Bacteria 122
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
2 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
5 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
6 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
7 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
8 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
9 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
10 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
11 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
12 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
15 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
16 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
31 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
34 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
35 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
36 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466727_140980 3300042655 Bacteria 1623
2 Ga0264413_104838 3300024493 Bacteria 10845
3 Ga0264413_109615 3300024493 Bacteria 4147
4 Ga0264413_117571 3300024493 Bacteria 5288
5 Ga0466694_123331 3300042594 Bacteria 14534
6 Ga0466694_181192 3300042594 Bacteria 3569
7 Ga0466718_148796 3300042617 Bacteria 2169
8 Ga0466726_029240 3300042619 Bacteria 4083
9 Ga0466706_182284 3300042599 Archaea 2397
10 Ga0466720_073424 3300042607 Bacteria 22318
11 Ga0466698_436664 3300042610 Bacteria 1731
12 AustNasuHG_c1001678 3300000089 Bacteria 7986
13 JGI24698J34947_10009654 3300002449 Bacteria 5287
14 JGI24695J34938_10001836 3300002450 Bacteria 17306
15 JGI24695J34938_10002085 3300002450 Bacteria 15669
16 Ga0072940_1033004 3300005200 Bacteria 18577
17 Ga0466705_265345 3300042612 Bacteria 7968
18 Ga0466732_062022 3300042656 Bacteria 12415
19 Ga0466732_142701 3300042656 Bacteria 3491
20 Ga0466709_256148 3300042648 Bacteria 9428
21 Ga0466692_056617 3300042591 Bacteria 76518
22 Ga0466693_436085 3300042592 Bacteria 47244
23 Ga0466699_008702 3300042597 Bacteria 3441
24 Ga0466699_076091 3300042597 Bacteria 13285
25 Ga0466699_151195 3300042597 Bacteria 4926
26 Ga0466699_170812 3300042597 Bacteria 8923
27 Ga0466699_272033 3300042597 Bacteria 1590
28 Ga0466715_190904 3300042616 Bacteria 17122
29 Ga0466718_035626 3300042617 Bacteria 6076
30 Ga0123356_10013186 3300010049 Bacteria 7994
31 Ga0123356_10053648 3300010049 Bacteria 3753
32 Ga0466720_031121 3300042607 Bacteria 38472
33 Ga0466720_207313 3300042607 Bacteria 9180
34 Ga0466722_070896 3300042609 Bacteria 8573
35 Ga0466722_086299 3300042609 Bacteria 6763
36 JGI24695J34938_10001518 3300002450 Bacteria 19554
37 JGI24695J34938_10002203 3300002450 Bacteria 15193
38 Ga0466732_252112 3300042656 Bacteria 23763
39 Ga0264413_119715 3300024493 Bacteria 5510
40 Ga0415639_060950 3300038395 Bacteria 8139
41 Ga0123356_10000424 3300010049 Bacteria 48165
42 Ga0466720_034302 3300042607 Bacteria 16753
43 Ga0466720_125260 3300042607 Bacteria 23757
44 Ga0466722_072288 3300042609 Bacteria 35823
45 Ga0466722_138105 3300042609 Bacteria 3956
46 JGI24698J34947_10009129 3300002449 Bacteria 5442
47 Ga0072940_1021372 3300005200 Bacteria 1981
48 Ga0072941_1005557 3300005201 Unclassified 3771
49 Ga0264413_116815 3300024493 Bacteria 2816
50 Ga0466694_164977 3300042594 Bacteria 16325
51 Ga0466699_300066 3300042597 Bacteria 5478
52 Ga0466705_436413 3300042612 Bacteria 1779
53 Ga0466712_148959 3300042614 Bacteria 8739
54 Ga0466715_100553 3300042616 Bacteria 10769
55 Ga0466718_003072 3300042617 Bacteria 21491
56 Ga0466718_026950 3300042617 Bacteria 19873
57 Ga0123356_10001823 3300010049 Bacteria 23151
58 Ga0123356_10014616 3300010049 Bacteria 7545
59 Ga0466707_133240 3300042601 Bacteria 4130
60 Ga0466720_139182 3300042607 Bacteria 5972
61 Ga0466721_384222 3300042608 Bacteria 17220
62 JGI24698J34947_10033772 3300002449 Bacteria 2681
63 JGI24695J34938_10000201 3300002450 Bacteria 56424
64 JGI24695J34938_10000659 3300002450 Bacteria 32678
65 Ga0072940_1001054 3300005200 Bacteria 8086
66 Ga0072940_1001997 3300005200 Bacteria 10646
67 Ga0466732_312754 3300042656 Bacteria 1347
68 Ga0264413_102958 3300024493 Bacteria 8604
69 Ga0264413_106871 3300024493 Bacteria 14804
70 Ga0466718_127023 3300042617 Bacteria 10226
71 Ga0123355_10059406 3300009826 Unclassified 6180
72 Ga0123356_10004189 3300010049 Bacteria 14952
73 Ga0466719_199083 3300042606 Bacteria 19265
74 Ga0466720_081695 3300042607 Bacteria 38075
75 Ga0466720_205466 3300042607 Bacteria 4709
76 Ga0466698_040838 3300042610 Bacteria 1550
77 JGI24695J34938_10000446 3300002450 Bacteria 39944
78 Ga0466705_119080 3300042612 Bacteria 13162
79 Ga0264413_109381 3300024493 Bacteria 5102
80 Ga0415639_084087 3300038395 Bacteria 13313
81 Ga0466692_114671 3300042591 Bacteria 7918
82 Ga0466699_060715 3300042597 Bacteria 3170
83 Ga0466699_164412 3300042597 Bacteria 3293
84 Ga0466699_186375 3300042597 Bacteria 32333
85 Ga0466699_216693 3300042597 Bacteria 5872
86 Ga0466720_033743 3300042607 Bacteria 60959
87 Ga0466720_154916 3300042607 Bacteria 17029
88 Ga0466722_067148 3300042609 Bacteria 1365
89 AustNasuHG_c1003860 3300000089 Bacteria 5398
90 Ga0264413_108749 3300024493 Bacteria 8662
91 Ga0264413_109614 3300024493 Bacteria 3723
92 Ga0466699_012651 3300042597 Bacteria 13207
93 Ga0466699_124852 3300042597 Bacteria 7971
94 Ga0466699_134791 3300042597 Bacteria 2167
95 Ga0466699_248293 3300042597 Bacteria 7769
96 Ga0466699_387070 3300042597 Bacteria 9030
97 Ga0123356_10197865 3300010049 Bacteria 2047
98 Ga0466720_025899 3300042607 Bacteria 56735
99 Ga0466720_196210 3300042607 Bacteria 16212
100 JGI24695J34938_10010759 3300002450 Bacteria 4977
101 Ga0072940_1012703 3300005200 Bacteria 7559
102 Ga0072941_1005556 3300005201 Bacteria 23397
103 Ga0466732_114344 3300042656 Bacteria 23924
104 Ga0466703_204264 3300042636 Bacteria 8670
105 Ga0264413_109617 3300024493 Bacteria 6355
106 Ga0264413_109688 3300024493 Bacteria 5425
107 Ga0466699_074386 3300042597 Bacteria 15229
108 Ga0466699_363856 3300042597 Bacteria 5726
109 Ga0466712_159857 3300042614 Bacteria 3061
110 Ga0466718_082810 3300042617 Bacteria 20578
111 Ga0466718_093124 3300042617 Bacteria 9460
112 Ga0466720_001126 3300042607 Bacteria 5795
113 Ga0466722_066738 3300042609 Unclassified 1308
114 Ga0466722_154573 3300042609 Bacteria 5072
115 Ga0466722_219069 3300042609 Bacteria 6596
116 AustNasuHG_c1010691 3300000089 Bacteria 3194
117 JGI24695J34938_10009636 3300002450 Bacteria 5357
118 JGI24705J35276_12223941 3300002504 Bacteria 2559

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_026950 Ga0466718_026950_3183_4379 375
2 3300042601 Ga0466707_133240 Ga0466707_133240_2872_4071 390
3 3300002450 JGI24695J34938_10001836 JGI24695J34938_100018364 394
4 3300042594 Ga0466694_181192 Ga0466694_181192_1603_2832 395
5 3300042597 Ga0466699_248293 Ga0466699_248293_3947_5248 395
6 3300042597 Ga0466699_272033 Ga0466699_272033_105_1292 395
7 3300000089 AustNasuHG_c1010691 AustNasuHG_10106912 396
8 3300042607 Ga0466720_154916 Ga0466720_154916_1818_3014 398
9 3300002450 JGI24695J34938_10000446 JGI24695J34938_1000044623 400
10 3300042656 Ga0466732_114344 Ga0466732_114344_5073_6278 401
11 3300024493 Ga0264413_119715 Ga0264413_1197155 404
12 3300002450 JGI24695J34938_10000659 JGI24695J34938_100006595 405
13 3300042597 Ga0466699_134791 Ga0466699_134791_96_1451 405
14 3300042597 Ga0466699_076091 Ga0466699_076091_7899_9197 406
15 3300002450 JGI24695J34938_10001518 JGI24695J34938_100015187 408
16 3300042591 Ga0466692_056617 Ga0466692_056617_19898_21139 408
17 3300042614 Ga0466712_148959 Ga0466712_148959_6081_7391 408
18 3300042616 Ga0466715_100553 Ga0466715_100553_3514_4863 410
19 3300005200 Ga0072940_1021372 Ga0072940_10213721 413
20 3300042607 Ga0466720_081695 Ga0466720_081695_6513_7841 413
21 3300042607 Ga0466720_196210 Ga0466720_196210_4556_5860 413
22 3300002450 JGI24695J34938_10009636 JGI24695J34938_100096362 416
23 3300009826 Ga0123355_10059406 Ga0123355_100594064 416
24 3300042617 Ga0466718_127023 Ga0466718_127023_3603_4907 416
25 3300042609 Ga0466722_154573 Ga0466722_154573_2710_3963 417
26 3300042655 Ga0466727_140980 Ga0466727_140980_56_1309 417
27 3300002450 JGI24695J34938_10010759 JGI24695J34938_100107594 418
28 3300024493 Ga0264413_106871 Ga0264413_1068718 418
29 3300024493 Ga0264413_108749 Ga0264413_1087494 418
30 3300042592 Ga0466693_436085 Ga0466693_436085_39834_41129 418
31 3300042597 Ga0466699_012651 Ga0466699_012651_6644_7957 418
32 3300042597 Ga0466699_060715 Ga0466699_060715_299_1612 418
33 3300042609 Ga0466722_066738 Ga0466722_066738_40_1296 418
34 3300002450 JGI24695J34938_10002203 JGI24695J34938_100022039 419
35 3300010049 Ga0123356_10197865 Ga0123356_101978652 419
36 3300042609 Ga0466722_072288 Ga0466722_072288_24222_25505 419
37 3300042597 Ga0466699_363856 Ga0466699_363856_1690_3009 420
38 3300042594 Ga0466694_123331 Ga0466694_123331_7994_9298 421
39 3300042597 Ga0466699_151195 Ga0466699_151195_2090_3409 421
40 3300042607 Ga0466720_001126 Ga0466720_001126_1828_3132 421
41 3300042609 Ga0466722_138105 Ga0466722_138105_2338_3666 421
42 3300042612 Ga0466705_436413 Ga0466705_436413_367_1653 421
43 3300042612 Ga0466705_265345 Ga0466705_265345_3958_5271 422
44 3300024493 Ga0264413_109617 Ga0264413_1096175 423
45 3300042617 Ga0466718_003072 Ga0466718_003072_1902_3230 423
46 3300042656 Ga0466732_142701 Ga0466732_142701_200_1504 423
47 3300024493 Ga0264413_102958 Ga0264413_1029589 424
48 3300042597 Ga0466699_124852 Ga0466699_124852_3043_4341 424
49 3300042656 Ga0466732_312754 Ga0466732_312754_16_1323 424
50 3300010049 Ga0123356_10000424 Ga0123356_1000042425 425
51 3300042606 Ga0466719_199083 Ga0466719_199083_5982_7292 425
52 3300000089 AustNasuHG_c1001678 AustNasuHG_10016784 426
53 3300024493 Ga0264413_117571 Ga0264413_1175713 426
54 3300042597 Ga0466699_387070 Ga0466699_387070_3233_4513 426
55 3300042608 Ga0466721_384222 Ga0466721_384222_10632_11933 426
56 3300042609 Ga0466722_219069 Ga0466722_219069_5193_6539 426
57 3300042597 Ga0466699_170812 Ga0466699_170812_3262_4566 427
58 3300005200 Ga0072940_1001054 Ga0072940_10010545 428
59 3300002450 JGI24695J34938_10002085 JGI24695J34938_1000208512 429
60 3300024493 Ga0264413_109688 Ga0264413_1096882 429
61 3300042609 Ga0466722_067148 Ga0466722_067148_40_1329 429
62 3300002449 JGI24698J34947_10033772 JGI24698J34947_100337722 430
63 3300002450 JGI24695J34938_10000201 JGI24695J34938_1000020113 430
64 3300010049 Ga0123356_10001823 Ga0123356_1000182314 430
65 3300010049 Ga0123356_10014616 Ga0123356_100146166 430
66 3300010049 Ga0123356_10053648 Ga0123356_100536483 430
67 3300038395 Ga0415639_084087 Ga0415639_084087_11240_12532 430
68 3300042599 Ga0466706_182284 Ga0466706_182284_258_1550 430
69 iso_pr_bacteria 2781125656 2781321187 430
70 iso_pr_bacteria 2781125662 2781337339 430
71 3300010049 Ga0123356_10004189 Ga0123356_100041895 431
72 iso_pr_bacteria 2781125647 2781303849 431
73 3300000089 AustNasuHG_c1003860 AustNasuHG_10038604 433
74 3300002449 JGI24698J34947_10009654 JGI24698J34947_100096543 433
75 3300005200 Ga0072940_1001997 Ga0072940_10019978 433
76 3300005200 Ga0072940_1012703 Ga0072940_10127034 433
77 3300024493 Ga0264413_104838 Ga0264413_1048384 434
78 3300042607 Ga0466720_031121 Ga0466720_031121_32491_33813 434
79 3300042607 Ga0466720_073424 Ga0466720_073424_13811_15115 434
80 3300042617 Ga0466718_093124 Ga0466718_093124_7545_8849 434
81 3300024493 Ga0264413_109381 Ga0264413_1093813 435
82 3300024493 Ga0264413_109614 Ga0264413_1096142 435
83 3300042609 Ga0466722_086299 Ga0466722_086299_3900_5234 435
84 3300042610 Ga0466698_436664 Ga0466698_436664_184_1521 435
85 3300042617 Ga0466718_082810 Ga0466718_082810_18387_19694 435
86 3300042597 Ga0466699_008702 Ga0466699_008702_1813_3126 437
87 3300042597 Ga0466699_186375 Ga0466699_186375_28719_30032 437
88 3300042597 Ga0466699_216693 Ga0466699_216693_2317_3630 437
89 3300042656 Ga0466732_062022 Ga0466732_062022_3377_4690 437
90 iso_pr_bacteria 2781125631 2781267661 437
91 iso_pr_bacteria 2781125695 2781438020 437
92 3300042612 Ga0466705_119080 Ga0466705_119080_4899_6215 438
93 3300042617 Ga0466718_035626 Ga0466718_035626_2829_4145 438
94 3300042617 Ga0466718_148796 Ga0466718_148796_88_1404 438
95 3300042636 Ga0466703_204264 Ga0466703_204264_5438_6754 438
96 3300042597 Ga0466699_074386 Ga0466699_074386_2302_3621 439
97 3300042607 Ga0466720_034302 Ga0466720_034302_4994_6313 439
98 3300042656 Ga0466732_252112 Ga0466732_252112_2226_3545 439
99 iso_pr_bacteria 2781125658 2781326441 439
100 3300010049 Ga0123356_10013186 Ga0123356_100131867 440
101 3300042607 Ga0466720_025899 Ga0466720_025899_43207_44529 440
102 3300042609 Ga0466722_070896 Ga0466722_070896_5157_6479 440
103 iso_pr_bacteria 2781125651 2781310367 440
104 3300024493 Ga0264413_109615 Ga0264413_1096153 441
105 3300042607 Ga0466720_205466 Ga0466720_205466_2284_3609 441
106 3300042614 Ga0466712_159857 Ga0466712_159857_276_1601 441
107 3300002449 JGI24698J34947_10009129 JGI24698J34947_100091294 442
108 3300042597 Ga0466699_300066 Ga0466699_300066_1576_2934 442
109 3300038395 Ga0415639_060950 Ga0415639_060950_6746_8077 443
110 3300042607 Ga0466720_125260 Ga0466720_125260_16337_17668 443
111 iso_pr_bacteria 2781125660 2781331282 443
112 3300002504 JGI24705J35276_12223941 JGI24705J35276_122239412 444
113 3300024493 Ga0264413_116815 Ga0264413_1168152 444
114 3300042607 Ga0466720_207313 Ga0466720_207313_3789_5123 444
115 3300042619 Ga0466726_029240 Ga0466726_029240_2594_3928 444
116 3300042616 Ga0466715_190904 Ga0466715_190904_13875_15215 446
117 3300005201 Ga0072941_1005557 Ga0072941_10055573 447
118 3300042607 Ga0466720_033743 Ga0466720_033743_14742_16088 448
119 3300042607 Ga0466720_139182 Ga0466720_139182_2248_3594 448
120 3300042610 Ga0466698_040838 Ga0466698_040838_153_1502 449
121 3300005200 Ga0072940_1033004 Ga0072940_103300412 450
122 3300042594 Ga0466694_164977 Ga0466694_164977_720_2072 450
123 3300042648 Ga0466709_256148 Ga0466709_256148_4374_5726 450
124 3300005201 Ga0072941_1005556 Ga0072941_100555619 451
125 3300042591 Ga0466692_114671 Ga0466692_114671_1402_2772 456
126 3300042597 Ga0466699_164412 Ga0466699_164412_423_1814 463

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02687 FtsX FtsX-like permease family 303 418 0.9
PF12704 MacB_PCD MacB-like periplasmic core domain 50 221 0.77

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02687 GO:0016020 membrane CC

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.66 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.