Protein Family IF05311

Metagenome Isolate
113 Members
36 Samples
109 Scaffolds
399.54 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_151461|Ga0466699_151461_488_1816
Length
442 aa
Sequence
LILPTSGLYRELNTFTLPKKLLHFYWECVIIVHGVLMMKTTDSSHGCGGLNPKRIKNIDAYLQRIVDQQKVAGVGGMVIRRGEEAYCSSFGMRDIAAKAALKNDSIYRIWSMSKTFTVVAAMTLYEKGLFALHQPIADFLPIFKDIKVAETDKRGIVRLVPAKRPVSFEHLFTMTSGIPYPGGDSFSAIAMGEILKKSQKAAKQGKAWNTTRMVQEAAKTPLCFHPGEQWLYGFSHDVLGRLIEVISGKSLGEYLLETIFKPLGLKDTAFYVPKEKQNRVVKPYRLSPKGLIEVNDDNDNASVHPPAFESGGGGLCSTMADCARYAQMLLNNGKLGNERILSRKTIELIKTNHCDISILRPSFFGHMTGYGYGLGVRTMLNPAESGLNGSLGEWAWDGMMGTYYLVDPQEEMIALFFIQLLSDINSDLQRGFVQTVYGAIDD

📊 Sample Types

Isolate 3.5%
Metagenome 96.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.1%
Kalotermitidae 36.1%
Unclassified 13.9%
Rhinotermitidae 5.6%
Termopsidae 5.6%
Hodotermitidae 2.8%

🌳 Taxonomy

Archaea 0
Bacteria 109
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
12 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
13 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
14 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
25 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_066349 3300042636 Bacteria 1015
2 Ga0466694_169566 3300042594 Bacteria 2186
3 Ga0466699_146309 3300042597 Bacteria 10230
4 Ga0466699_151461 3300042597 Bacteria 1958
5 Ga0466699_431938 3300042597 Bacteria 4966
6 Ga0466712_106017 3300042614 Bacteria 17927
7 Ga0466715_316708 3300042616 Bacteria 14321
8 Ga0466718_120850 3300042617 Bacteria 2426
9 Ga0466707_143792 3300042601 Bacteria 1895
10 Ga0466720_032380 3300042607 Bacteria 2115
11 Ga0123353_10084140 3300010167 Bacteria 5122
12 Ga0123354_10212154 3300010882 Bacteria 2088
13 Ga0123357_10000067 3300009784 Bacteria 84688
14 Ga0466733_093470 3300042659 Bacteria 1760
15 Ga0466704_355449 3300042643 Bacteria 30070
16 Ga0466709_178776 3300042648 Bacteria 2936
17 Ga0466708_133590 3300042652 Bacteria 9141
18 Ga0466708_199190 3300042652 Bacteria 13660
19 Ga0466727_317036 3300042655 Bacteria 5230
20 Ga0466692_042064 3300042591 Bacteria 35435
21 Ga0466696_236256 3300042596 Bacteria 9193
22 Ga0466696_254416 3300042596 Bacteria 3453
23 Ga0466715_361239 3300042616 Bacteria 18181
24 Ga0466723_159777 3300042618 Bacteria 18771
25 Ga0466707_212480 3300042601 Bacteria 6865
26 Ga0466722_002890 3300042609 Bacteria 6147
27 Ga0123353_10123719 3300010167 Bacteria 4157
28 JGI24698J34947_10000538 3300002449 Bacteria 17931
29 JGI24698J34947_10003784 3300002449 Unclassified 8248
30 JGI24702J35022_10000946 3300002462 Bacteria 18130
31 Ga0466709_319052 3300042648 Bacteria 1290
32 Ga0466694_309770 3300042594 Bacteria 3503
33 Ga0466694_334735 3300042594 Bacteria 8732
34 Ga0466696_048706 3300042596 Bacteria 5778
35 Ga0466712_089435 3300042614 Bacteria 21004
36 Ga0466712_229000 3300042614 Bacteria 5098
37 Ga0466711_242205 3300042615 Bacteria 1845
38 Ga0466715_270894 3300042616 Bacteria 4431
39 Ga0466726_088059 3300042619 Bacteria 2952
40 Ga0466716_159815 3300042605 Bacteria 2951
41 Ga0466719_258165 3300042606 Bacteria 2202
42 Ga0466719_403397 3300042606 Bacteria 3964
43 Ga0466705_051600 3300042612 Bacteria 19485
44 Ga0466705_296557 3300042612 Bacteria 1120
45 Ga0466704_136057 3300042643 Bacteria 12193
46 Ga0466704_293437 3300042643 Bacteria 2014
47 Ga0466696_182547 3300042596 Bacteria 1850
48 Ga0466699_246270 3300042597 Bacteria 4146
49 Ga0466699_399714 3300042597 Bacteria 1652
50 Ga0466715_193455 3300042616 Bacteria 17182
51 Ga0466723_206398 3300042618 Bacteria 7654
52 Ga0466726_358037 3300042619 Bacteria 2394
53 Ga0466716_045075 3300042605 Bacteria 3258
54 Ga0123353_10304000 3300010167 Bacteria 2433
55 Ga0466733_051903 3300042659 Bacteria 1451
56 Ga0466690_367139 3300042590 Unclassified 1753
57 Ga0466699_139912 3300042597 Bacteria 31344
58 Ga0466712_087319 3300042614 Bacteria 1822
59 Ga0466715_158211 3300042616 Bacteria 3465
60 Ga0466726_039256 3300042619 Bacteria 4200
61 Ga0466728_003211 3300042620 Bacteria 5624
62 Ga0466728_032846 3300042620 Bacteria 4474
63 Ga0466720_047240 3300042607 Bacteria 4621
64 Ga0466720_067444 3300042607 Bacteria 4048
65 Ga0466722_048945 3300042609 Bacteria 20210
66 Ga0123354_10028363 3300010882 Bacteria 8815
67 JGI24698J34947_10000146 3300002449 Bacteria 26723
68 Ga0466733_006608 3300042659 Bacteria 2876
69 Ga0466703_020081 3300042636 Bacteria 8176
70 Ga0466704_013984 3300042643 Bacteria 11572
71 Ga0466704_060348 3300042643 Bacteria 10863
72 Ga0466704_228096 3300042643 Unclassified 22263
73 Ga0466709_078658 3300042648 Bacteria 23318
74 Ga0466708_075398 3300042652 Bacteria 5125
75 Ga0466699_088592 3300042597 Unclassified 4506
76 Ga0466699_223677 3300042597 Bacteria 10897
77 Ga0466712_050319 3300042614 Bacteria 7546
78 Ga0466715_044081 3300042616 Bacteria 3009
79 Ga0466718_021379 3300042617 Bacteria 1983
80 Ga0466707_315246 3300042601 Bacteria 3505
81 Ga0466721_209094 3300042608 Bacteria 15941
82 Ga0466722_030046 3300042609 Bacteria 6211
83 Ga0123353_10283195 3300010167 Bacteria 2544
84 Ga0123353_10359025 3300010167 Bacteria 2190
85 Ga0466703_428332 3300042636 Bacteria 3041
86 Ga0466704_028660 3300042643 Bacteria 11729
87 Ga0466704_308379 3300042643 Bacteria 3486
88 Ga0466709_205480 3300042648 Bacteria 1698
89 Ga0466694_168467 3300042594 Bacteria 9413
90 Ga0466711_309753 3300042615 Bacteria 9404
91 Ga0466711_331443 3300042615 Bacteria 2675
92 Ga0466718_119972 3300042617 Bacteria 2231
93 Ga0466723_169065 3300042618 Bacteria 9233
94 Ga0466706_142745 3300042599 Bacteria 2029
95 Ga0466719_027711 3300042606 Bacteria 13730
96 JGI24698J34947_10001605 3300002449 Bacteria 12020
97 JGI24698J34947_10003288 3300002449 Bacteria 8761
98 Ga0466705_102427 3300042612 Bacteria 4276
99 Ga0466703_176823 3300042636 Bacteria 21183
100 Ga0466704_449505 3300042643 Bacteria 7231
101 Ga0466699_435813 3300042597 Bacteria 2891
102 Ga0466712_235684 3300042614 Bacteria 9231
103 Ga0466715_626399 3300042616 Bacteria 1871
104 Ga0466716_200942 3300042605 Bacteria 8497
105 Ga0466716_243475 3300042605 Bacteria 3455
106 AustNasuHG_c1000154 3300000089 Bacteria 21784
107 AustNasuHG_c1017196 3300000089 Bacteria 2409
108 JGI24698J34947_10001300 3300002449 Bacteria 13099
109 JGI24698J34947_10018002 3300002449 Bacteria 3823

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_066349 Ga0466703_066349_19_996 314
2 3300042612 Ga0466705_296557 Ga0466705_296557_103_1101 332
3 3300042605 Ga0466716_159815 Ga0466716_159815_1859_2881 340
4 3300042590 Ga0466690_367139 Ga0466690_367139_76_1140 354
5 3300042659 Ga0466733_006608 Ga0466733_006608_1746_2849 367
6 3300042648 Ga0466709_205480 Ga0466709_205480_34_1182 376
7 3300042591 Ga0466692_042064 Ga0466692_042064_34076_35269 379
8 3300042609 Ga0466722_030046 Ga0466722_030046_1405_2616 382
9 3300042636 Ga0466703_020081 Ga0466703_020081_5795_6997 385
10 3300042652 Ga0466708_133590 Ga0466708_133590_3536_4708 385
11 3300042619 Ga0466726_039256 Ga0466726_039256_1294_2496 387
12 3300042620 Ga0466728_003211 Ga0466728_003211_400_1563 387
13 3300042655 Ga0466727_317036 Ga0466727_317036_153_1385 387
14 3300042615 Ga0466711_309753 Ga0466711_309753_2261_3460 388
15 3300042643 Ga0466704_449505 Ga0466704_449505_2256_3440 389
16 3300042596 Ga0466696_182547 Ga0466696_182547_308_1519 391
17 3300042643 Ga0466704_228096 Ga0466704_228096_13095_14297 391
18 3300010167 Ga0123353_10084140 Ga0123353_100841405 392
19 3300042618 Ga0466723_169065 Ga0466723_169065_3931_5139 393
20 3300042605 Ga0466716_243475 Ga0466716_243475_1874_3073 394
21 3300042616 Ga0466715_193455 Ga0466715_193455_2904_4109 395
22 3300042616 Ga0466715_158211 Ga0466715_158211_1961_3184 397
23 3300042616 Ga0466715_270894 Ga0466715_270894_247_1470 397
24 3300042605 Ga0466716_200942 Ga0466716_200942_665_1861 398
25 3300042609 Ga0466722_048945 Ga0466722_048945_2047_3261 399
26 3300042619 Ga0466726_358037 Ga0466726_358037_232_1461 399
27 3300042606 Ga0466719_027711 Ga0466719_027711_3924_5126 400
28 3300042606 Ga0466719_403397 Ga0466719_403397_950_2152 400
29 3300042612 Ga0466705_051600 Ga0466705_051600_6847_8049 400
30 3300042643 Ga0466704_308379 Ga0466704_308379_300_1502 400
31 3300042652 Ga0466708_199190 Ga0466708_199190_7817_9019 400
32 3300000089 AustNasuHG_c1017196 AustNasuHG_10171962 401
33 3300002462 JGI24702J35022_10000946 JGI24702J35022_100009468 401
34 3300042596 Ga0466696_236256 Ga0466696_236256_2597_3802 401
35 3300042601 Ga0466707_315246 Ga0466707_315246_2102_3307 401
36 3300042606 Ga0466719_258165 Ga0466719_258165_424_1629 401
37 3300042607 Ga0466720_032380 Ga0466720_032380_163_1368 401
38 3300042607 Ga0466720_047240 Ga0466720_047240_3217_4422 401
39 3300042607 Ga0466720_067444 Ga0466720_067444_1119_2324 401
40 3300042614 Ga0466712_050319 Ga0466712_050319_586_1791 401
41 3300042614 Ga0466712_229000 Ga0466712_229000_134_1339 401
42 3300042615 Ga0466711_242205 Ga0466711_242205_444_1649 401
43 3300042617 Ga0466718_120850 Ga0466718_120850_992_2197 401
44 3300042620 Ga0466728_032846 Ga0466728_032846_1132_2337 401
45 3300042643 Ga0466704_028660 Ga0466704_028660_1295_2500 401
46 3300042643 Ga0466704_136057 Ga0466704_136057_3460_4665 401
47 iso_pr_bacteria 650716099 650880333 401
48 3300000089 AustNasuHG_c1000154 AustNasuHG_100015410 402
49 3300010167 Ga0123353_10359025 Ga0123353_103590251 402
50 3300042596 Ga0466696_048706 Ga0466696_048706_4517_5725 402
51 3300042599 Ga0466706_142745 Ga0466706_142745_608_1816 402
52 3300042605 Ga0466716_045075 Ga0466716_045075_1406_2614 402
53 3300042615 Ga0466711_331443 Ga0466711_331443_1299_2507 402
54 3300042616 Ga0466715_361239 Ga0466715_361239_1651_2859 402
55 3300042618 Ga0466723_206398 Ga0466723_206398_6037_7245 402
56 3300042636 Ga0466703_428332 Ga0466703_428332_133_1341 402
57 3300042643 Ga0466704_013984 Ga0466704_013984_2292_3500 402
58 3300042648 Ga0466709_178776 Ga0466709_178776_304_1512 402
59 3300042648 Ga0466709_319052 Ga0466709_319052_36_1244 402
60 3300042652 Ga0466708_075398 Ga0466708_075398_3024_4232 402
61 3300042596 Ga0466696_254416 Ga0466696_254416_513_1724 403
62 3300042597 Ga0466699_146309 Ga0466699_146309_8121_9332 403
63 3300042597 Ga0466699_399714 Ga0466699_399714_152_1363 403
64 3300042614 Ga0466712_087319 Ga0466712_087319_531_1742 403
65 3300042614 Ga0466712_089435 Ga0466712_089435_1259_2470 403
66 3300042614 Ga0466712_106017 Ga0466712_106017_10519_11730 403
67 3300042614 Ga0466712_235684 Ga0466712_235684_7245_8456 403
68 3300042617 Ga0466718_021379 Ga0466718_021379_719_1930 403
69 3300042636 Ga0466703_176823 Ga0466703_176823_10265_11476 403
70 3300042659 Ga0466733_051903 Ga0466733_051903_208_1419 403
71 iso_pr_bacteria 2781125666 2781342982 403
72 3300002449 JGI24698J34947_10000538 JGI24698J34947_100005385 404
73 3300002449 JGI24698J34947_10001300 JGI24698J34947_100013008 404
74 3300002449 JGI24698J34947_10001605 JGI24698J34947_100016056 404
75 3300002449 JGI24698J34947_10003288 JGI24698J34947_100032886 404
76 3300002449 JGI24698J34947_10003784 JGI24698J34947_100037845 404
77 3300002449 JGI24698J34947_10018002 JGI24698J34947_100180022 404
78 3300009784 Ga0123357_10000067 Ga0123357_100000672 404
79 3300010167 Ga0123353_10283195 Ga0123353_102831952 404
80 3300010167 Ga0123353_10304000 Ga0123353_103040002 404
81 3300042594 Ga0466694_169566 Ga0466694_169566_246_1460 404
82 3300042601 Ga0466707_143792 Ga0466707_143792_43_1257 404
83 3300042609 Ga0466722_002890 Ga0466722_002890_1835_3049 404
84 iso_pr_bacteria 2781125688 2781422787 404
85 3300002449 JGI24698J34947_10000146 JGI24698J34947_1000014611 405
86 3300010167 Ga0123353_10123719 Ga0123353_101237192 405
87 3300010882 Ga0123354_10028363 Ga0123354_1002836311 405
88 3300042594 Ga0466694_168467 Ga0466694_168467_7798_9015 405
89 3300042594 Ga0466694_334735 Ga0466694_334735_1462_2679 405
90 3300042597 Ga0466699_088592 Ga0466699_088592_1493_2710 405
91 3300042601 Ga0466707_212480 Ga0466707_212480_5537_6754 405
92 3300042612 Ga0466705_102427 Ga0466705_102427_1589_2806 405
93 3300042616 Ga0466715_044081 Ga0466715_044081_1283_2500 405
94 3300042643 Ga0466704_293437 Ga0466704_293437_503_1720 405
95 3300042659 Ga0466733_093470 Ga0466733_093470_51_1268 405
96 iso_pr_bacteria 2781125693 2781433956 405
97 3300042608 Ga0466721_209094 Ga0466721_209094_4465_5685 406
98 3300042617 Ga0466718_119972 Ga0466718_119972_808_2028 406
99 3300010882 Ga0123354_10212154 Ga0123354_102121542 407
100 3300042616 Ga0466715_316708 Ga0466715_316708_8178_9401 407
101 3300042597 Ga0466699_246270 Ga0466699_246270_1872_3101 409
102 3300042597 Ga0466699_139912 Ga0466699_139912_6451_7683 410
103 3300042616 Ga0466715_626399 Ga0466715_626399_206_1438 410
104 3300042618 Ga0466723_159777 Ga0466723_159777_17335_18570 411
105 3300042648 Ga0466709_078658 Ga0466709_078658_981_2216 411
106 3300042597 Ga0466699_223677 Ga0466699_223677_1634_2872 412
107 3300042643 Ga0466704_060348 Ga0466704_060348_527_1777 416
108 3300042597 Ga0466699_431938 Ga0466699_431938_805_2061 418
109 3300042643 Ga0466704_355449 Ga0466704_355449_5736_6992 418
110 3300042594 Ga0466694_309770 Ga0466694_309770_1644_2909 421
111 3300042597 Ga0466699_435813 Ga0466699_435813_1339_2628 429
112 3300042619 Ga0466726_088059 Ga0466726_088059_611_1903 430
113 3300042597 Ga0466699_151461 Ga0466699_151461_488_1816 442

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00144 Beta-lactamase Beta-lactamase 58 421 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.