Protein Family IF05301

Metagenome Isolate
178 Members
45 Samples
172 Scaffolds
281.31 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_127162|Ga0466699_127162_202_1179
Length
325 aa
Sequence
MLVLIRIIMATSAPKYTRIQIEAITTPTTEFFFEFFARNIKLLYTFPPFSARIIGMNLRESSLPAGWYPRNPDEIGRFLSGMERGSGRAAIAPHAGWRFSGKIAAAATASLGMDIDTLAVIGGHLPAGYPTLFAMEDSVSTPLGPMPVHAALRAVLVKELDGHEDAFPDNTVEVLLPMARYFFPDASLLWLRLPAEKSSFDAGKTIAAAALNLGCKLAVLGSSDLTHYGPNYGFTPQGTGPQALQWMRDTNDRRFIDAVLSGDPAAVLERAEKDRSSCSAGAVLGAMGFASAQGASSARLIQYGTSADTMDADSFVGYAAIAFPG

📊 Sample Types

Isolate 3.4%
Metagenome 96.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.2%
Kalotermitidae 30.2%
Unclassified 16.3%
Rhinotermitidae 7.0%
Termopsidae 4.7%
Blaberidae 2.3%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 1
Bacteria 174
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
8 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
9 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
10 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
11 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
12 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
13 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2772190975 Treponema sp. RmG30 Isolate Blaberidae
23 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
24 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
25 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
26 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
27 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
30 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
31 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
32 2228664002 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3a from Florida, USA Metagenome Termitidae
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
38 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
39 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
40 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
41 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
42 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_205209 3300042599 Bacteria 2868
2 Ga0466719_099995 3300042606 Bacteria 30212
3 Ga0466720_033636 3300042607 Bacteria 19556
4 Ga0466712_042388 3300042614 Bacteria 1089
5 Ga0466712_075270 3300042614 Bacteria 7691
6 Ga0466712_185316 3300042614 Bacteria 1834
7 Ga0466711_121475 3300042615 Bacteria 27728
8 Ga0466715_320405 3300042616 Bacteria 3062
9 Ga0466718_074071 3300042617 Bacteria 2541
10 Ga0466723_148841 3300042618 Bacteria 18796
11 JGI24695J34938_10008927 3300002450 Bacteria 5650
12 Ga0072940_1023820 3300005200 Bacteria 5234
13 Ga0072941_1007689 3300005201 Bacteria 10058
14 Ga0072941_1007692 3300005201 Archaea 2335
15 Ga0466732_118319 3300042656 Bacteria 5409
16 Ga0466705_255983 3300042612 Bacteria 1857
17 Ga0466703_007936 3300042636 Bacteria 2878
18 Ga0264413_122520 3300024493 Bacteria 9334
19 Ga0466690_014403 3300042590 Bacteria 3931
20 Ga0466692_151515 3300042591 Bacteria 25092
21 Ga0466699_114365 3300042597 Bacteria 18005
22 Ga0466699_236052 3300042597 Unclassified 1347
23 Ga0466699_267011 3300042597 Bacteria 5079
24 Ga0466699_268323 3300042597 Bacteria 30824
25 Ga0123356_10223007 3300010049 Bacteria 1943
26 Ga0466719_458128 3300042606 Bacteria 4027
27 Ga0466705_485305 3300042612 Bacteria 2804
28 Ga0466712_126726 3300042614 Bacteria 3373
29 Ga0466711_197597 3300042615 Bacteria 20853
30 Ga0466718_043233 3300042617 Bacteria 14865
31 Ga0466718_091888 3300042617 Bacteria 2498
32 Ga0466723_053830 3300042618 Bacteria 8166
33 JGI24698J34947_10044715 3300002449 Bacteria 2264
34 Ga0466705_168708 3300042612 Bacteria 15467
35 Ga0466709_047824 3300042648 Bacteria 2088
36 Ga0466708_165936 3300042652 Unclassified 1614
37 Ga0466708_244761 3300042652 Bacteria 3290
38 Ga0466708_467939 3300042652 Bacteria 6432
39 Ga0264413_127389 3300024493 Bacteria 1760
40 Ga0466694_159625 3300042594 Bacteria 2318
41 Ga0466699_204718 3300042597 Bacteria 1123
42 Ga0466720_068435 3300042607 Bacteria 10011
43 Ga0466720_085594 3300042607 Bacteria 4199
44 Ga0466712_130107 3300042614 Bacteria 2010
45 Ga0466712_184151 3300042614 Bacteria 5116
46 Ga0466718_074363 3300042617 Bacteria 12808
47 Ga0466726_033479 3300042619 Bacteria 3112
48 Ga0466726_430525 3300042619 Bacteria 6079
49 Ga0466726_485611 3300042619 Bacteria 3713
50 Ga0466729_087631 3300042621 Bacteria 1211
51 JGI24698J34947_10022761 3300002449 Bacteria 3356
52 JGI24698J34947_10027437 3300002449 Bacteria 3022
53 Ga0072941_1034905 3300005201 Bacteria 5951
54 Ga0466732_181817 3300042656 Bacteria 2354
55 Ga0466732_224357 3300042656 Bacteria 2049
56 Ga0466703_120600 3300042636 Bacteria 41888
57 Ga0466709_029749 3300042648 Bacteria 1165
58 Ga0264413_106796 3300024493 Bacteria 14843
59 Ga0264413_109607 3300024493 Bacteria 10809
60 Ga0264413_116701 3300024493 Bacteria 4731
61 Ga0466690_086499 3300042590 Bacteria 4595
62 Ga0466694_080334 3300042594 Bacteria 5067
63 Ga0466699_006506 3300042597 Bacteria 1202
64 Ga0466700_105325 3300042600 Bacteria 1320
65 Ga0466716_498917 3300042605 Bacteria 1701
66 Ga0466720_007399 3300042607 Bacteria 4580
67 Ga0466720_020352 3300042607 Bacteria 5742
68 Ga0466722_208764 3300042609 Bacteria 3733
69 Ga0466726_441464 3300042619 Bacteria 2132
70 JGI24698J34947_10002083 3300002449 Bacteria 10700
71 JGI24698J34947_10006058 3300002449 Bacteria 6641
72 JGI24702J35022_10040329 3300002462 Bacteria 2490
73 Ga0466732_117448 3300042656 Bacteria 1275
74 Ga0466732_356690 3300042656 Bacteria 7352
75 Ga0264413_103197 3300024493 Bacteria 5262
76 Ga0466699_075484 3300042597 Bacteria 10304
77 Ga0466699_154742 3300042597 Bacteria 9949
78 Ga0466707_197977 3300042601 Bacteria 2124
79 Ga0466719_159558 3300042606 Bacteria 30542
80 Ga0466719_383414 3300042606 Bacteria 5820
81 Ga0466720_008518 3300042607 Bacteria 19922
82 Ga0466720_048845 3300042607 Bacteria 5904
83 Ga0466720_053586 3300042607 Bacteria 5590
84 Ga0466698_350466 3300042610 Bacteria 1513
85 Ga0466712_134322 3300042614 Bacteria 5847
86 Ga0466715_035589 3300042616 Bacteria 6044
87 Ga0466718_118289 3300042617 Bacteria 4051
88 Ga0466718_163999 3300042617 Bacteria 16130
89 Ga0466726_137695 3300042619 Bacteria 2252
90 JGI24698J34947_10002867 3300002449 Bacteria 9355
91 JGI24698J34947_10015302 3300002449 Bacteria 4176
92 Ga0072940_1024875 3300005200 Bacteria 3940
93 Ga0072941_1007690 3300005201 Bacteria 2441
94 Ga0466705_019109 3300042612 Bacteria 3335
95 Ga0466705_046515 3300042612 Bacteria 21587
96 Ga0466702_337300 3300042635 Bacteria 13720
97 Ga0466690_240952 3300042590 Bacteria 3769
98 Ga0466694_127418 3300042594 Bacteria 8996
99 Ga0466699_130690 3300042597 Bacteria 7400
100 Ga0466699_200099 3300042597 Bacteria 2091
101 Ga0466699_263768 3300042597 Bacteria 7427
102 Ga0466700_167652 3300042600 Bacteria 2471
103 Ga0466713_133695 3300042602 Bacteria 1868
104 Ga0466719_338684 3300042606 Bacteria 1781
105 Ga0466720_063818 3300042607 Bacteria 3641
106 Ga0466720_109763 3300042607 Bacteria 16893
107 Ga0466722_122699 3300042609 Bacteria 6430
108 Ga0466698_485537 3300042610 Bacteria 4310
109 Ga0466712_050770 3300042614 Bacteria 36007
110 Ga0466712_120522 3300042614 Bacteria 21561
111 Ga0466712_165381 3300042614 Bacteria 3127
112 Ga0466711_139938 3300042615 Bacteria 4593
113 Ga0466718_049211 3300042617 Bacteria 7929
114 JGI24698J34947_10074555 3300002449 Bacteria 1616
115 JGI24695J34938_10006114 3300002450 Bacteria 7326
116 Ga0072941_1007691 3300005201 Bacteria 7673
117 Ga0072941_1033704 3300005201 Bacteria 2591
118 Ga0466732_119822 3300042656 Bacteria 1657
119 Ga0466732_282592 3300042656 Bacteria 22717
120 Ga0466705_091246 3300042612 Bacteria 2083
121 Ga0466704_323776 3300042643 Bacteria 3961
122 Ga0264413_108494 3300024493 Bacteria 26731
123 Ga0264413_136161 3300024493 Unclassified 1400
124 Ga0264413_136162 3300024493 Bacteria 1344
125 Ga0264413_139894 3300024493 Bacteria 1845
126 Ga0466691_082520 3300042593 Bacteria 10291
127 Ga0466691_172663 3300042593 Bacteria 2073
128 Ga0466694_031614 3300042594 Bacteria 2687
129 Ga0466694_156694 3300042594 Bacteria 1553
130 Ga0466694_189956 3300042594 Bacteria 1128
131 Ga0466699_003650 3300042597 Bacteria 2493
132 Ga0466699_220203 3300042597 Bacteria 2636
133 Ga0466720_130442 3300042607 Bacteria 11175
134 Ga0466720_198506 3300042607 Bacteria 1043
135 Ga0466722_136591 3300042609 Bacteria 3296
136 Ga0466712_002119 3300042614 Bacteria 5352
137 Ga0466712_023019 3300042614 Bacteria 12855
138 Ga0466718_012681 3300042617 Bacteria 63390
139 Ga0466723_002650 3300042618 Bacteria 6865
140 Ga0466726_234291 3300042619 Bacteria 1622
141 2230941925 2228664002 Bacteria 10305
142 JGI24698J34947_10000950 3300002449 Bacteria 14745
143 JGI24698J34947_10002690 3300002449 Bacteria 9596
144 JGI24698J34947_10004430 3300002449 Bacteria 7644
145 Ga0466703_365426 3300042636 Bacteria 12555
146 Ga0264413_110770 3300024493 Bacteria 12322
147 Ga0466690_152260 3300042590 Bacteria 1055
148 Ga0466691_043505 3300042593 Bacteria 8840
149 Ga0466696_070385 3300042596 Bacteria 6644
150 Ga0466699_012984 3300042597 Bacteria 13934
151 Ga0466699_022579 3300042597 Bacteria 7803
152 Ga0466699_154533 3300042597 Bacteria 1279
153 Ga0466699_237049 3300042597 Bacteria 12893
154 Ga0466699_325739 3300042597 Bacteria 6193
155 Ga0466716_139151 3300042605 Bacteria 5305
156 Ga0466720_040357 3300042607 Bacteria 25359
157 Ga0466720_207766 3300042607 Bacteria 1065
158 Ga0466712_224738 3300042614 Bacteria 3722
159 Ga0466715_390126 3300042616 Bacteria 3164
160 Ga0466723_180236 3300042618 Bacteria 45509
161 Ga0466726_270658 3300042619 Bacteria 1198
162 JGI24698J34947_10000854 3300002449 Bacteria 15334
163 JGI24698J34947_10014590 3300002449 Bacteria 4279
164 JGI24695J34938_10107904 3300002450 Bacteria 1135
165 JGI24699J35502_11131587 3300002509 Bacteria 5835
166 Ga0072941_1001886 3300005201 Bacteria 139305
167 Ga0466704_445716 3300042643 Bacteria 38256
168 Ga0466704_483259 3300042643 Bacteria 4257
169 Ga0466727_112839 3300042655 Bacteria 1227
170 Ga0466694_328093 3300042594 Bacteria 1271
171 Ga0466699_127162 3300042597 Bacteria 1297
172 Ga0466699_368546 3300042597 Bacteria 23219

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_136161 Ga0264413_1361612 235
2 3300042648 Ga0466709_029749 Ga0466709_029749_290_997 235
3 iso_pr_bacteria 2781125633 2781273220 258
4 3300002450 JGI24695J34938_10006114 JGI24695J34938_100061144 259
5 3300042614 Ga0466712_126726 Ga0466712_126726_320_1177 262
6 3300002509 JGI24699J35502_11131587 JGI24699J35502_111315873 263
7 3300042594 Ga0466694_127418 Ga0466694_127418_2298_3164 263
8 3300042614 Ga0466712_130107 Ga0466712_130107_385_1227 263
9 3300002449 JGI24698J34947_10074555 JGI24698J34947_100745552 264
10 3300042606 Ga0466719_383414 Ga0466719_383414_1323_2198 265
11 3300042597 Ga0466699_075484 Ga0466699_075484_2962_3765 267
12 3300042597 Ga0466699_220203 Ga0466699_220203_485_1288 267
13 3300042656 Ga0466732_282592 Ga0466732_282592_13752_14615 267
14 3300042597 Ga0466699_130690 Ga0466699_130690_2413_3219 268
15 iso_pr_bacteria 2781125651 2781310227 269
16 3300002450 JGI24695J34938_10008927 JGI24695J34938_100089273 270
17 3300005200 Ga0072940_1023820 Ga0072940_10238204 270
18 3300042597 Ga0466699_154533 Ga0466699_154533_169_981 270
19 3300042601 Ga0466707_197977 Ga0466707_197977_1010_1822 270
20 3300042636 Ga0466703_120600 Ga0466703_120600_32730_33581 270
21 3300005201 Ga0072941_1007692 Ga0072941_10076921 271
22 3300042590 Ga0466690_152260 Ga0466690_152260_61_876 271
23 3300042597 Ga0466699_154742 Ga0466699_154742_3048_3863 271
24 3300042619 Ga0466726_234291 Ga0466726_234291_55_900 271
25 3300005201 Ga0072941_1007689 Ga0072941_10076897 272
26 3300042602 Ga0466713_133695 Ga0466713_133695_183_1070 272
27 iso_pr_bacteria 2781125640 2781289013 272
28 3300002449 JGI24698J34947_10004430 JGI24698J34947_100044303 273
29 3300024493 Ga0264413_108494 Ga0264413_10849425 273
30 3300024493 Ga0264413_116701 Ga0264413_1167012 273
31 3300042594 Ga0466694_159625 Ga0466694_159625_153_974 273
32 3300042607 Ga0466720_040357 Ga0466720_040357_23022_23843 273
33 3300042617 Ga0466718_049211 Ga0466718_049211_4178_4999 273
34 3300042617 Ga0466718_074071 Ga0466718_074071_1331_2152 273
35 3300042617 Ga0466718_091888 Ga0466718_091888_1266_2087 273
36 3300042617 Ga0466718_163999 Ga0466718_163999_8260_9081 273
37 3300042619 Ga0466726_441464 Ga0466726_441464_308_1171 273
38 3300042615 Ga0466711_139938 Ga0466711_139938_1520_2383 274
39 3300042655 Ga0466727_112839 Ga0466727_112839_79_903 274
40 3300042656 Ga0466732_119822 Ga0466732_119822_203_1027 274
41 2228664002 2230941925 2230643753 275
42 3300002449 JGI24698J34947_10002690 JGI24698J34947_100026906 275
43 3300024493 Ga0264413_139894 Ga0264413_1398942 275
44 3300042591 Ga0466692_151515 Ga0466692_151515_20283_21110 275
45 3300042597 Ga0466699_012984 Ga0466699_012984_10165_10992 275
46 3300042597 Ga0466699_022579 Ga0466699_022579_3141_3968 275
47 3300042597 Ga0466699_267011 Ga0466699_267011_2305_3132 275
48 3300042597 Ga0466699_325739 Ga0466699_325739_112_939 275
49 3300042607 Ga0466720_033636 Ga0466720_033636_4623_5450 275
50 3300042607 Ga0466720_053586 Ga0466720_053586_1686_2513 275
51 3300042609 Ga0466722_208764 Ga0466722_208764_261_1088 275
52 3300042610 Ga0466698_350466 Ga0466698_350466_268_1095 275
53 3300042614 Ga0466712_002119 Ga0466712_002119_3787_4614 275
54 iso_pr_bacteria 2772190975 2773723113 275
55 3300002449 JGI24698J34947_10000950 JGI24698J34947_100009509 276
56 3300002449 JGI24698J34947_10044715 JGI24698J34947_100447152 276
57 3300002450 JGI24695J34938_10107904 JGI24695J34938_101079041 276
58 3300005201 Ga0072941_1001886 Ga0072941_1001886124 276
59 3300005201 Ga0072941_1007691 Ga0072941_10076917 276
60 3300005201 Ga0072941_1034905 Ga0072941_10349056 276
61 3300024493 Ga0264413_106796 Ga0264413_1067966 276
62 3300042594 Ga0466694_080334 Ga0466694_080334_791_1621 276
63 3300042594 Ga0466694_156694 Ga0466694_156694_125_955 276
64 3300042597 Ga0466699_204718 Ga0466699_204718_24_854 276
65 3300042597 Ga0466699_237049 Ga0466699_237049_7319_8149 276
66 3300042609 Ga0466722_122699 Ga0466722_122699_3500_4330 276
67 3300042609 Ga0466722_136591 Ga0466722_136591_1707_2537 276
68 3300002449 JGI24698J34947_10002083 JGI24698J34947_100020835 277
69 3300042597 Ga0466699_263768 Ga0466699_263768_2829_3662 277
70 3300042599 Ga0466706_205209 Ga0466706_205209_476_1309 277
71 3300042607 Ga0466720_109763 Ga0466720_109763_8914_9747 277
72 3300042612 Ga0466705_046515 Ga0466705_046515_9714_10547 277
73 3300042656 Ga0466732_117448 Ga0466732_117448_121_954 277
74 3300005201 Ga0072941_1007690 Ga0072941_10076903 278
75 3300024493 Ga0264413_122520 Ga0264413_1225204 278
76 3300042593 Ga0466691_082520 Ga0466691_082520_8277_9113 278
77 3300042594 Ga0466694_328093 Ga0466694_328093_35_871 278
78 3300042607 Ga0466720_068435 Ga0466720_068435_9083_9919 278
79 3300042607 Ga0466720_198506 Ga0466720_198506_156_992 278
80 3300042614 Ga0466712_120522 Ga0466712_120522_6726_7562 278
81 3300042635 Ga0466702_337300 Ga0466702_337300_9580_10416 278
82 3300042643 Ga0466704_445716 Ga0466704_445716_28799_29635 278
83 3300002449 JGI24698J34947_10006058 JGI24698J34947_100060583 279
84 3300002449 JGI24698J34947_10027437 JGI24698J34947_100274372 279
85 3300024493 Ga0264413_103197 Ga0264413_1031974 279
86 3300024493 Ga0264413_109607 Ga0264413_1096078 279
87 3300024493 Ga0264413_136162 Ga0264413_1361621 279
88 3300042593 Ga0466691_172663 Ga0466691_172663_35_874 279
89 3300042597 Ga0466699_368546 Ga0466699_368546_1108_1947 279
90 3300042607 Ga0466720_048845 Ga0466720_048845_336_1175 279
91 3300042607 Ga0466720_063818 Ga0466720_063818_402_1241 279
92 3300042607 Ga0466720_085594 Ga0466720_085594_1589_2428 279
93 3300042618 Ga0466723_148841 Ga0466723_148841_11327_12166 279
94 3300042619 Ga0466726_270658 Ga0466726_270658_95_934 279
95 3300042619 Ga0466726_485611 Ga0466726_485611_415_1254 279
96 3300042656 Ga0466732_118319 Ga0466732_118319_4389_5228 279
97 3300042656 Ga0466732_181817 Ga0466732_181817_157_996 279
98 iso_pr_bacteria 2781125658 2781326359 279
99 3300042607 Ga0466720_020352 Ga0466720_020352_4859_5701 280
100 3300042610 Ga0466698_485537 Ga0466698_485537_850_1692 280
101 3300042612 Ga0466705_255983 Ga0466705_255983_823_1665 280
102 3300042614 Ga0466712_075270 Ga0466712_075270_2546_3388 280
103 3300005201 Ga0072941_1033704 Ga0072941_10337043 281
104 3300024493 Ga0264413_127389 Ga0264413_1273892 281
105 3300042594 Ga0466694_031614 Ga0466694_031614_525_1370 281
106 3300042597 Ga0466699_236052 Ga0466699_236052_77_922 281
107 3300042617 Ga0466718_043233 Ga0466718_043233_5604_6449 281
108 3300042618 Ga0466723_180236 Ga0466723_180236_36184_37083 281
109 3300002449 JGI24698J34947_10000854 JGI24698J34947_100008549 282
110 3300002449 JGI24698J34947_10014590 JGI24698J34947_100145902 282
111 3300002449 JGI24698J34947_10015302 JGI24698J34947_100153022 282
112 3300002449 JGI24698J34947_10022761 JGI24698J34947_100227614 282
113 3300002462 JGI24702J35022_10040329 JGI24702J35022_100403292 282
114 3300042607 Ga0466720_130442 Ga0466720_130442_8297_9145 282
115 iso_pr_bacteria 2781125689 2781426081 282
116 3300010049 Ga0123356_10223007 Ga0123356_102230073 283
117 3300042594 Ga0466694_189956 Ga0466694_189956_103_954 283
118 3300042596 Ga0466696_070385 Ga0466696_070385_5278_6129 283
119 3300042619 Ga0466726_430525 Ga0466726_430525_55_906 283
120 3300002449 JGI24698J34947_10002867 JGI24698J34947_100028676 284
121 3300005200 Ga0072940_1024875 Ga0072940_10248755 284
122 3300042607 Ga0466720_008518 Ga0466720_008518_6077_6931 284
123 3300042652 Ga0466708_165936 Ga0466708_165936_497_1369 284
124 3300024493 Ga0264413_110770 Ga0264413_11077010 285
125 3300042607 Ga0466720_007399 Ga0466720_007399_644_1501 285
126 3300042656 Ga0466732_224357 Ga0466732_224357_1109_1966 285
127 3300042600 Ga0466700_167652 Ga0466700_167652_656_1516 286
128 3300042612 Ga0466705_019109 Ga0466705_019109_548_1408 286
129 3300042612 Ga0466705_091246 Ga0466705_091246_538_1398 286
130 3300042616 Ga0466715_320405 Ga0466715_320405_322_1182 286
131 3300042643 Ga0466704_483259 Ga0466704_483259_1513_2373 286
132 3300042590 Ga0466690_086499 Ga0466690_086499_1950_2813 287
133 3300042617 Ga0466718_012681 Ga0466718_012681_12886_13749 287
134 3300042617 Ga0466718_074363 Ga0466718_074363_8074_8937 287
135 3300042656 Ga0466732_356690 Ga0466732_356690_5614_6480 288
136 3300042612 Ga0466705_485305 Ga0466705_485305_335_1204 289
137 3300042614 Ga0466712_185316 Ga0466712_185316_403_1272 289
138 3300042615 Ga0466711_197597 Ga0466711_197597_12777_13679 289
139 3300042619 Ga0466726_137695 Ga0466726_137695_562_1455 289
140 3300042636 Ga0466703_007936 Ga0466703_007936_1366_2235 289
141 3300042593 Ga0466691_043505 Ga0466691_043505_4503_5375 290
142 3300042615 Ga0466711_121475 Ga0466711_121475_23407_24279 290
143 3300042597 Ga0466699_006506 Ga0466699_006506_24_899 291
144 3300042590 Ga0466690_014403 Ga0466690_014403_1088_1966 292
145 3300042597 Ga0466699_114365 Ga0466699_114365_11922_12800 292
146 3300042597 Ga0466699_268323 Ga0466699_268323_2803_3681 292
147 3300042606 Ga0466719_159558 Ga0466719_159558_22116_22994 292
148 3300042606 Ga0466719_338684 Ga0466719_338684_33_911 292
149 3300042614 Ga0466712_134322 Ga0466712_134322_1115_1993 292
150 3300042618 Ga0466723_053830 Ga0466723_053830_3715_4593 292
151 3300042652 Ga0466708_244761 Ga0466708_244761_2100_2978 292
152 3300042617 Ga0466718_118289 Ga0466718_118289_764_1645 293
153 3300042600 Ga0466700_105325 Ga0466700_105325_272_1156 294
154 3300042606 Ga0466719_099995 Ga0466719_099995_9916_10800 294
155 3300042606 Ga0466719_458128 Ga0466719_458128_326_1297 294
156 3300042607 Ga0466720_207766 Ga0466720_207766_89_973 294
157 3300042636 Ga0466703_365426 Ga0466703_365426_2236_3120 294
158 3300042652 Ga0466708_467939 Ga0466708_467939_1871_2770 294
159 3300042616 Ga0466715_035589 Ga0466715_035589_3244_4134 296
160 3300042597 Ga0466699_200099 Ga0466699_200099_202_1095 297
161 3300042619 Ga0466726_033479 Ga0466726_033479_1164_2057 297
162 3300042621 Ga0466729_087631 Ga0466729_087631_272_1165 297
163 3300042605 Ga0466716_139151 Ga0466716_139151_1233_2129 298
164 3300042590 Ga0466690_240952 Ga0466690_240952_1705_2604 299
165 3300042643 Ga0466704_323776 Ga0466704_323776_1150_2055 301
166 3300042616 Ga0466715_390126 Ga0466715_390126_669_1577 302
167 3300042648 Ga0466709_047824 Ga0466709_047824_420_1331 303
168 3300042605 Ga0466716_498917 Ga0466716_498917_585_1499 304
169 3300042614 Ga0466712_165381 Ga0466712_165381_1362_2276 304
170 3300042614 Ga0466712_224738 Ga0466712_224738_2454_3368 304
171 3300042612 Ga0466705_168708 Ga0466705_168708_14257_15177 306
172 3300042614 Ga0466712_184151 Ga0466712_184151_525_1448 307
173 3300042614 Ga0466712_042388 Ga0466712_042388_28_963 311
174 3300042614 Ga0466712_050770 Ga0466712_050770_25460_26398 312
175 3300042618 Ga0466723_002650 Ga0466723_002650_1480_2418 312
176 3300042597 Ga0466699_003650 Ga0466699_003650_964_1917 317
177 3300042614 Ga0466712_023019 Ga0466712_023019_925_1881 318
178 3300042597 Ga0466699_127162 Ga0466699_127162_202_1179 325

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01875 Memo Memo-like protein 67 321 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.