Protein Family IF05280

Metagenome Isolate
152 Members
48 Samples
143 Scaffolds
419.59 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_054907|Ga0466699_054907_11208_12668
Length
486 aa
Sequence
VFTALTGIWSDFAPSVAQISVLLTFWWPVCLIVPNIVPMCTSWAAANAGARGYKPRLYAFFTFLGHTVTMEIQKITDQQLESLLVPRFMNYVRYWTESDRHVEATPSSLGQWDLARALQGELLGLGVTDVELTPHCYVIARLPASTGRENAPVVGFLAHLDTANDVSGKDVSPQLVRNYDGETIALSGGLTLNPAKESGLAEQKGKAIIHSSGDTLLGADDKAGIAEIMAAVEYLAAHPEIPHGPVEVLFSPDEETGKGLPEFPLEKIKSAVCYTLDGGPIGEIEAECFNAWKADIECTGKVIHLGTARGVLANAALMAASYAVMLPRSESPEATDGYYGYYCPMELSGGLESARLEIFVRDFESNGIKRRLEALEAIAKAVEAQFPNGRVIVKTSPQYYNMREKIGEKPQALERLKAALDNTGIGWRLKPIRGGTDGSRLTEMGIPTPNIFTGGRNFHSRLEWVAVSEMCAASRLVIELIRLWGE

📊 Sample Types

Isolate 5.9%
Metagenome 94.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.5%
Kalotermitidae 26.1%
Unclassified 19.6%
Rhinotermitidae 6.5%
Termopsidae 4.3%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 1
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
22 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
33 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
36 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
40 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
41 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
42 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_096713 3300042614 Bacteria 9797
2 Ga0466712_320398 3300042614 Unclassified 1719
3 Ga0466711_242122 3300042615 Bacteria 1847
4 Ga0466718_001814 3300042617 Bacteria 3372
5 Ga0466718_074547 3300042617 Bacteria 15424
6 Ga0466728_115103 3300042620 Bacteria 5613
7 Ga0466720_001832 3300042607 Bacteria 3169
8 Ga0466720_019755 3300042607 Bacteria 3743
9 Ga0466720_233106 3300042607 Bacteria 42880
10 Ga0466722_005215 3300042609 Bacteria 9985
11 Ga0466698_294627 3300042610 Bacteria 1608
12 Ga0466704_561110 3300042643 Bacteria 7849
13 Ga0466694_094780 3300042594 Bacteria 2018
14 Ga0466699_068459 3300042597 Bacteria 23612
15 Ga0466699_250291 3300042597 Bacteria 49857
16 JGI24698J34947_10004392 3300002449 Bacteria 7673
17 JGI24695J34938_10000339 3300002450 Bacteria 46161
18 JGI24695J34938_10000638 3300002450 Bacteria 33425
19 Ga0466705_085342 3300042612 Bacteria 11173
20 Ga0466712_014889 3300042614 Bacteria 58641
21 Ga0466712_079080 3300042614 Unclassified 3078
22 Ga0466712_106176 3300042614 Bacteria 11255
23 Ga0466712_172842 3300042614 Bacteria 4312
24 Ga0466712_208852 3300042614 Bacteria 6962
25 Ga0466726_018267 3300042619 Bacteria 2285
26 Ga0466717_184442 3300042604 Bacteria 2307
27 Ga0466720_049135 3300042607 Bacteria 3427
28 Ga0466720_121414 3300042607 Bacteria 2952
29 Ga0466720_155926 3300042607 Bacteria 8087
30 Ga0466722_076177 3300042609 Bacteria 29982
31 Ga0415639_019683 3300038395 Bacteria 4950
32 Ga0466692_204781 3300042591 Bacteria 2577
33 Ga0466696_363235 3300042596 Bacteria 9044
34 Ga0466699_083059 3300042597 Bacteria 1657
35 JGI24698J34947_10038380 3300002449 Bacteria 2484
36 Ga0072941_1078936 3300005201 Bacteria 2142
37 Ga0466732_152032 3300042656 Bacteria 16830
38 Ga0123356_10000063 3300010049 Bacteria 111723
39 Ga0123356_10111150 3300010049 Bacteria 2647
40 Ga0466712_190509 3300042614 Bacteria 3345
41 Ga0466712_197672 3300042614 Bacteria 27405
42 Ga0466715_318281 3300042616 Bacteria 7650
43 Ga0466723_015264 3300042618 Bacteria 20872
44 Ga0466720_040705 3300042607 Unclassified 3026
45 Ga0466720_074735 3300042607 Bacteria 14166
46 Ga0466702_005888 3300042635 Bacteria 1983
47 Ga0466704_334572 3300042643 Bacteria 24393
48 Ga0466708_290132 3300042652 Bacteria 5315
49 Ga0466692_092840 3300042591 Bacteria 19467
50 Ga0466693_021526 3300042592 Bacteria 40073
51 Ga0466699_124796 3300042597 Bacteria 11856
52 AustNasuHG_c1000778 3300000089 Bacteria 11371
53 AustNasuHG_c1001656 3300000089 Bacteria 8030
54 JGI24698J34947_10010364 3300002449 Viruses 5111
55 JGI24698J34947_10012783 3300002449 Bacteria 4594
56 JGI24695J34938_10001058 3300002450 Bacteria 24980
57 JGI24695J34938_10001921 3300002450 Bacteria 16770
58 JGI24695J34938_10038393 3300002450 Bacteria 2169
59 Ga0072940_1019089 3300005200 Bacteria 4796
60 Ga0072941_1002626 3300005201 Bacteria 4382
61 Ga0072941_1008375 3300005201 Bacteria 46242
62 Ga0072941_1016189 3300005201 Bacteria 4050
63 Ga0072941_1035223 3300005201 Bacteria 6846
64 Ga0466712_003489 3300042614 Bacteria 9502
65 Ga0466715_090402 3300042616 Bacteria 11159
66 Ga0466723_234455 3300042618 Bacteria 13642
67 Ga0466720_108188 3300042607 Bacteria 2342
68 Ga0466720_234494 3300042607 Bacteria 24308
69 Ga0466709_210607 3300042648 Bacteria 9464
70 Ga0466708_049646 3300042652 Bacteria 17359
71 Ga0264413_102820 3300024493 Bacteria 21633
72 Ga0466694_099577 3300042594 Bacteria 97987
73 JGI24698J34947_10007078 3300002449 Bacteria 6163
74 JGI24695J34938_10004103 3300002450 Bacteria 9710
75 JGI24695J34938_10024799 3300002450 Bacteria 2876
76 Ga0072941_1103072 3300005201 Bacteria 2857
77 Ga0466732_181080 3300042656 Bacteria 6138
78 Ga0123356_10000034 3300010049 Bacteria 149865
79 Ga0123356_10040478 3300010049 Bacteria 4342
80 Ga0466712_187290 3300042614 Unclassified 12180
81 Ga0466718_040373 3300042617 Bacteria 43603
82 Ga0466729_053287 3300042621 Bacteria 2955
83 Ga0466691_138961 3300042593 Bacteria 7941
84 Ga0466694_146969 3300042594 Bacteria 18139
85 Ga0466694_284619 3300042594 Bacteria 2287
86 Ga0466699_063007 3300042597 Bacteria 4270
87 Ga0466699_152090 3300042597 Bacteria 7786
88 Ga0466699_250841 3300042597 Bacteria 13968
89 JGI24698J34947_10005347 3300002449 Bacteria 7043
90 JGI24695J34938_10010181 3300002450 Bacteria 5176
91 Ga0466732_225559 3300042656 Bacteria 17786
92 Ga0123356_10000120 3300010049 Bacteria 85763
93 Ga0123356_10002470 3300010049 Bacteria 19739
94 Ga0123356_10003845 3300010049 Bacteria 15640
95 Ga0123356_10130383 3300010049 Bacteria 2462
96 Ga0123353_10074694 3300010167 Bacteria 5449
97 Ga0466712_041345 3300042614 Bacteria 10603
98 Ga0466712_065155 3300042614 Bacteria 3226
99 Ga0466712_066093 3300042614 Bacteria 8090
100 Ga0466715_273780 3300042616 Bacteria 15926
101 Ga0466720_156791 3300042607 Bacteria 1762
102 Ga0466703_094648 3300042636 Bacteria 7107
103 Ga0264413_104765 3300024493 Bacteria 3250
104 Ga0466690_122739 3300042590 Bacteria 16947
105 Ga0466694_161993 3300042594 Bacteria 2698
106 Ga0466699_054907 3300042597 Bacteria 12987
107 Ga0072941_1000285 3300005201 Bacteria 12800
108 Ga0466732_207623 3300042656 Bacteria 13905
109 Ga0123353_10452082 3300010167 Bacteria 1891
110 Ga0466712_007226 3300042614 Bacteria 3769
111 Ga0466712_049149 3300042614 Bacteria 2764
112 Ga0466711_399810 3300042615 Bacteria 4367
113 Ga0466715_501244 3300042616 Bacteria 18463
114 Ga0466718_072200 3300042617 Bacteria 3295
115 Ga0466718_144021 3300042617 Bacteria 5974
116 Ga0466723_008859 3300042618 Bacteria 3099
117 Ga0466720_019008 3300042607 Bacteria 18978
118 Ga0466708_038315 3300042652 Bacteria 5243
119 Ga0466727_247045 3300042655 Bacteria 3776
120 Ga0264413_103394 3300024493 Bacteria 29703
121 Ga0264413_104061 3300024493 Bacteria 24138
122 2230929947 2228664001 Bacteria 8707
123 JGI24698J34947_10000326 3300002449 Bacteria 21051
124 JGI24698J34947_10014726 3300002449 Bacteria 4261
125 JGI24695J34938_10001974 3300002450 Bacteria 16383
126 JGI24695J34938_10021724 3300002450 Bacteria 3133
127 JGI24702J35022_10008267 3300002462 Bacteria 5899
128 Ga0466705_210081 3300042612 Bacteria 20349
129 Ga0123355_10222430 3300009826 Bacteria 2712
130 Ga0466718_022534 3300042617 Bacteria 17892
131 Ga0466720_022178 3300042607 Bacteria 17065
132 Ga0466720_227520 3300042607 Bacteria 2370
133 Ga0466722_053513 3300042609 Bacteria 19310
134 Ga0466722_111455 3300042609 Bacteria 7413
135 Ga0264413_100183 3300024493 Bacteria 10534
136 Ga0264413_102035 3300024493 Bacteria 16598
137 Ga0415639_040258 3300038395 Bacteria 2801
138 Ga0466699_171843 3300042597 Bacteria 6511
139 JGI24698J34947_10059372 3300002449 Bacteria 1891
140 JGI24695J34938_10000835 3300002450 Bacteria 28598
141 JGI24695J34938_10004774 3300002450 Bacteria 8733
142 JGI24695J34938_10010982 3300002450 Bacteria 4918
143 JGI24695J34938_10025621 3300002450 Bacteria 2816

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_318281 Ga0466715_318281_37_1245 402
2 3300002450 JGI24695J34938_10004103 JGI24695J34938_100041036 406
3 3300002450 JGI24695J34938_10021724 JGI24695J34938_100217242 406
4 3300042617 Ga0466718_144021 Ga0466718_144021_4150_5373 407
5 3300042609 Ga0466722_053513 Ga0466722_053513_16574_17833 408
6 3300042635 Ga0466702_005888 Ga0466702_005888_521_1750 409
7 3300042607 Ga0466720_019755 Ga0466720_019755_842_2074 410
8 3300042617 Ga0466718_072200 Ga0466718_072200_699_1931 410
9 3300042617 Ga0466718_074547 Ga0466718_074547_9724_10956 410
10 iso_pr_bacteria 2781125660 2781330323 410
11 3300002450 JGI24695J34938_10000835 JGI24695J34938_1000083526 411
12 3300002450 JGI24695J34938_10001921 JGI24695J34938_1000192111 411
13 3300002450 JGI24695J34938_10025621 JGI24695J34938_100256212 411
14 3300002450 JGI24695J34938_10038393 JGI24695J34938_100383932 411
15 3300009826 Ga0123355_10222430 Ga0123355_102224303 411
16 3300010049 Ga0123356_10000063 Ga0123356_1000006310 411
17 3300010049 Ga0123356_10111150 Ga0123356_101111502 411
18 3300024493 Ga0264413_104765 Ga0264413_1047652 411
19 3300038395 Ga0415639_040258 Ga0415639_040258_915_2150 411
20 iso_pr_bacteria 2781125638 2781285137 411
21 iso_pr_bacteria 2781125657 2781322482 411
22 3300010049 Ga0123356_10000034 Ga0123356_10000034103 412
23 3300010049 Ga0123356_10000120 Ga0123356_1000012048 412
24 3300042592 Ga0466693_021526 Ga0466693_021526_20168_21406 412
25 3300042607 Ga0466720_019008 Ga0466720_019008_895_2133 412
26 3300042614 Ga0466712_096713 Ga0466712_096713_3770_5008 412
27 3300042614 Ga0466712_106176 Ga0466712_106176_5482_6720 412
28 3300042614 Ga0466712_187290 Ga0466712_187290_2341_3579 412
29 3300042614 Ga0466712_190509 Ga0466712_190509_1506_2744 412
30 3300042652 Ga0466708_038315 Ga0466708_038315_3101_4339 412
31 3300002449 JGI24698J34947_10004392 JGI24698J34947_100043924 413
32 3300002449 JGI24698J34947_10005347 JGI24698J34947_100053472 413
33 3300002449 JGI24698J34947_10007078 JGI24698J34947_100070786 413
34 3300002449 JGI24698J34947_10059372 JGI24698J34947_100593721 413
35 3300002450 JGI24695J34938_10000339 JGI24695J34938_1000033947 413
36 3300002450 JGI24695J34938_10001058 JGI24695J34938_1000105814 413
37 3300005201 Ga0072941_1000285 Ga0072941_10002859 413
38 3300005201 Ga0072941_1002626 Ga0072941_10026266 413
39 3300005201 Ga0072941_1078936 Ga0072941_10789362 413
40 3300005201 Ga0072941_1103072 Ga0072941_11030723 413
41 3300010049 Ga0123356_10040478 Ga0123356_100404782 413
42 3300010049 Ga0123356_10130383 Ga0123356_101303833 413
43 3300010167 Ga0123353_10074694 Ga0123353_100746944 413
44 3300024493 Ga0264413_102035 Ga0264413_1020355 413
45 3300042614 Ga0466712_197672 Ga0466712_197672_22953_24194 413
46 3300042617 Ga0466718_001814 Ga0466718_001814_1919_3160 413
47 3300002449 JGI24698J34947_10010364 JGI24698J34947_100103643 414
48 3300005201 Ga0072941_1016189 Ga0072941_10161893 414
49 3300042615 Ga0466711_242122 Ga0466711_242122_529_1773 414
50 3300042618 Ga0466723_008859 Ga0466723_008859_185_1429 414
51 3300042648 Ga0466709_210607 Ga0466709_210607_3452_4696 414
52 3300005200 Ga0072940_1019089 Ga0072940_10190896 415
53 3300042607 Ga0466720_040705 Ga0466720_040705_260_1507 415
54 3300042607 Ga0466720_155926 Ga0466720_155926_4289_5536 415
55 3300042614 Ga0466712_014889 Ga0466712_014889_12549_13796 415
56 3300002450 JGI24695J34938_10001974 JGI24695J34938_100019749 416
57 3300038395 Ga0415639_019683 Ga0415639_019683_2453_3703 416
58 3300042597 Ga0466699_083059 Ga0466699_083059_250_1500 416
59 3300042597 Ga0466699_152090 Ga0466699_152090_1041_2291 416
60 3300042597 Ga0466699_250841 Ga0466699_250841_9629_10879 416
61 iso_pr_bacteria 2781125665 2781341081 416
62 3300002450 JGI24695J34938_10004774 JGI24695J34938_100047743 417
63 3300002450 JGI24695J34938_10010181 JGI24695J34938_100101813 417
64 3300010049 Ga0123356_10002470 Ga0123356_1000247015 417
65 3300010167 Ga0123353_10452082 Ga0123353_104520822 417
66 3300042621 Ga0466729_053287 Ga0466729_053287_638_1891 417
67 3300002450 JGI24695J34938_10024799 JGI24695J34938_100247992 418
68 3300042609 Ga0466722_111455 Ga0466722_111455_3411_4667 418
69 3300042616 Ga0466715_090402 Ga0466715_090402_1675_2931 418
70 iso_pr_bacteria 2781125656 2781322174 418
71 2228664001 2230929947 2230625249 419
72 3300024493 Ga0264413_102820 Ga0264413_10282024 419
73 3300024493 Ga0264413_104061 Ga0264413_1040615 419
74 3300042593 Ga0466691_138961 Ga0466691_138961_6104_7363 419
75 3300042594 Ga0466694_161993 Ga0466694_161993_288_1547 419
76 3300042594 Ga0466694_284619 Ga0466694_284619_407_1666 419
77 3300042596 Ga0466696_363235 Ga0466696_363235_3448_4707 419
78 3300042597 Ga0466699_124796 Ga0466699_124796_298_1557 419
79 3300042597 Ga0466699_171843 Ga0466699_171843_2049_3308 419
80 3300042597 Ga0466699_250291 Ga0466699_250291_2564_3823 419
81 3300042604 Ga0466717_184442 Ga0466717_184442_327_1586 419
82 3300042607 Ga0466720_022178 Ga0466720_022178_1274_2533 419
83 3300042607 Ga0466720_049135 Ga0466720_049135_639_1898 419
84 3300042607 Ga0466720_074735 Ga0466720_074735_1671_2930 419
85 3300042607 Ga0466720_108188 Ga0466720_108188_16_1275 419
86 3300042607 Ga0466720_121414 Ga0466720_121414_504_1763 419
87 3300042607 Ga0466720_156791 Ga0466720_156791_167_1426 419
88 3300042607 Ga0466720_227520 Ga0466720_227520_290_1549 419
89 3300042607 Ga0466720_233106 Ga0466720_233106_6355_7614 419
90 3300042610 Ga0466698_294627 Ga0466698_294627_262_1521 419
91 3300042612 Ga0466705_210081 Ga0466705_210081_10828_12087 419
92 3300042614 Ga0466712_003489 Ga0466712_003489_134_1393 419
93 3300042614 Ga0466712_007226 Ga0466712_007226_654_1913 419
94 3300042614 Ga0466712_041345 Ga0466712_041345_1032_2291 419
95 3300042614 Ga0466712_049149 Ga0466712_049149_123_1382 419
96 3300042614 Ga0466712_065155 Ga0466712_065155_816_2075 419
97 3300042614 Ga0466712_066093 Ga0466712_066093_3900_5159 419
98 3300042614 Ga0466712_079080 Ga0466712_079080_1182_2441 419
99 3300042614 Ga0466712_172842 Ga0466712_172842_559_1818 419
100 3300042614 Ga0466712_208852 Ga0466712_208852_2917_4176 419
101 3300042614 Ga0466712_320398 Ga0466712_320398_428_1687 419
102 3300042616 Ga0466715_273780 Ga0466715_273780_3650_4909 419
103 3300042617 Ga0466718_022534 Ga0466718_022534_7287_8546 419
104 3300042620 Ga0466728_115103 Ga0466728_115103_1650_2909 419
105 3300042643 Ga0466704_334572 Ga0466704_334572_11129_12388 419
106 3300042656 Ga0466732_152032 Ga0466732_152032_5437_6696 419
107 iso_pr_bacteria 2781125658 2781325938 419
108 iso_pr_bacteria 2781125696 2781440706 419
109 3300000089 AustNasuHG_c1000778 AustNasuHG_10007784 420
110 3300002449 JGI24698J34947_10000326 JGI24698J34947_100003265 420
111 3300002449 JGI24698J34947_10012783 JGI24698J34947_100127833 420
112 3300002449 JGI24698J34947_10014726 JGI24698J34947_100147261 420
113 3300002449 JGI24698J34947_10038380 JGI24698J34947_100383802 420
114 3300002462 JGI24702J35022_10008267 JGI24702J35022_100082673 420
115 3300005201 Ga0072941_1008375 Ga0072941_100837517 420
116 3300010049 Ga0123356_10003845 Ga0123356_1000384513 420
117 3300042652 Ga0466708_290132 Ga0466708_290132_3855_5117 420
118 3300000089 AustNasuHG_c1001656 AustNasuHG_10016563 421
119 3300042607 Ga0466720_234494 Ga0466720_234494_19516_20781 421
120 3300042615 Ga0466711_399810 Ga0466711_399810_945_2210 421
121 3300042636 Ga0466703_094648 Ga0466703_094648_250_1515 421
122 3300042656 Ga0466732_225559 Ga0466732_225559_8214_9479 421
123 iso_pr_bacteria 2781125693 2781434808 421
124 3300024493 Ga0264413_103394 Ga0264413_10339418 422
125 3300042612 Ga0466705_085342 Ga0466705_085342_5075_6343 422
126 3300042616 Ga0466715_501244 Ga0466715_501244_12275_13543 422
127 3300042643 Ga0466704_561110 Ga0466704_561110_3361_4629 422
128 3300042652 Ga0466708_049646 Ga0466708_049646_11170_12438 422
129 3300042591 Ga0466692_204781 Ga0466692_204781_1081_2352 423
130 3300042597 Ga0466699_063007 Ga0466699_063007_1261_2538 425
131 3300042618 Ga0466723_015264 Ga0466723_015264_13506_14783 425
132 3300042594 Ga0466694_094780 Ga0466694_094780_215_1498 427
133 3300042619 Ga0466726_018267 Ga0466726_018267_779_2065 428
134 3300042609 Ga0466722_076177 Ga0466722_076177_8090_9385 431
135 3300042594 Ga0466694_146969 Ga0466694_146969_11384_12682 432
136 3300042591 Ga0466692_092840 Ga0466692_092840_14183_15484 433
137 iso_pr_bacteria 2781125644 2781296439 433
138 3300002450 JGI24695J34938_10000638 JGI24695J34938_1000063819 434
139 3300005201 Ga0072941_1035223 Ga0072941_10352238 435
140 3300042607 Ga0466720_001832 Ga0466720_001832_1800_3110 436
141 3300042617 Ga0466718_040373 Ga0466718_040373_5919_7229 436
142 3300042618 Ga0466723_234455 Ga0466723_234455_10062_11372 436
143 3300042655 Ga0466727_247045 Ga0466727_247045_1932_3242 436
144 3300002450 JGI24695J34938_10010982 JGI24695J34938_100109824 438
145 3300042590 Ga0466690_122739 Ga0466690_122739_2239_3555 438
146 3300024493 Ga0264413_100183 Ga0264413_1001833 439
147 3300042656 Ga0466732_181080 Ga0466732_181080_2747_4069 440
148 3300042656 Ga0466732_207623 Ga0466732_207623_7889_9214 441
149 3300042594 Ga0466694_099577 Ga0466694_099577_75677_77005 442
150 3300042597 Ga0466699_068459 Ga0466699_068459_320_1666 448
151 3300042597 Ga0466699_054907 Ga0466699_054907_11208_12668 486
152 3300042609 Ga0466722_005215 Ga0466722_005215_1269_2771 500

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 219 481 0.83

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01546 GO:0016787 hydrolase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.