Protein Family IF05265

Metagenome Metatranscriptome Isolate
157 Members
47 Samples
152 Scaffolds
139.71 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_009307|Ga0466699_009307_17229_17711
Length
160 aa
Sequence
VLNSILIDAGPLIALFDSSDRHHKGIKSFLKENPYRYISTVAVFTEVSHMLDFSVHAQRDFYEWIMCKGVFISDINQNDMPRIVRLTEQYADLPMDFADATLVVTAEKTGIQEIISLDRDFDVYRLPGKERIHNVYRLSSISSPLNLRDSKSPPYHHRAG

📊 Sample Types

Isolate 3.2%
Metagenome 96.2%
MAG 0.0%
Metatranscriptome 0.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 61.4%
Kalotermitidae 15.9%
Unclassified 11.4%
Rhinotermitidae 6.8%
Hodotermitidae 2.3%
Termopsidae 2.3%

🌳 Taxonomy

Archaea 1
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 44

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
4 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
12 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
13 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
14 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
17 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
18 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
19 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
20 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
21 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
28 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
32 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
33 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
34 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
38 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
39 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
42 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
47 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10006065 3300009826 Bacteria 17813
2 Ga0123356_10396662 3300010049 Bacteria 1516
3 Ga0123353_10040284 3300010167 Bacteria 7369
4 Ga0466694_246529 3300042594 Bacteria 4228
5 Ga0466699_023620 3300042597 Bacteria 5908
6 Ga0466699_235884 3300042597 Bacteria 2242
7 Ga0466731_018351 3300042622 Bacteria 2101
8 FAAS_10003252 3300001880 Unclassified 1297
9 JGI24698J34947_10012663 3300002449 Bacteria 4619
10 JGI24698J34947_10014065 3300002449 Bacteria 4360
11 JGI24698J34947_10020297 3300002449 Bacteria 3580
12 Ga0072941_1005276 3300005201 Bacteria 11022
13 Ga0072941_1012930 3300005201 Bacteria 9401
14 Ga0072941_1012931 3300005201 Bacteria 7611
15 Ga0072941_1080852 3300005201 Unclassified 3686
16 Ga0466718_094439 3300042617 Bacteria 10276
17 Ga0123353_12695632 3300010167 Unclassified 585
18 Ga0466692_117010 3300042591 Bacteria 1234
19 Ga0466694_288050 3300042594 Bacteria 21720
20 Ga0466699_316478 3300042597 Bacteria 2243
21 Ga0466700_046389 3300042600 Bacteria 15689
22 Ga0466716_040936 3300042605 Bacteria 3237
23 Ga0466720_105696 3300042607 Unclassified 2363
24 Ga0466720_133387 3300042607 Bacteria 11769
25 Ga0466703_073711 3300042636 Bacteria 9670
26 AustNasuHG_c1024788 3300000089 Unclassified 1894
27 JGI24695J34938_10049924 3300002450 Bacteria 1837
28 JGI24705J35276_12209653 3300002504 Bacteria 1803
29 JGI24699J35502_11129138 3300002509 Bacteria 4611
30 Ga0072941_1050434 3300005201 Unclassified 1186
31 Ga0466705_074942 3300042612 Bacteria 7803
32 Ga0466733_145737 3300042659 Bacteria 1945
33 Ga0466712_142301 3300042614 Bacteria 17272
34 Ga0466712_156915 3300042614 Bacteria 21573
35 Ga0466718_005689 3300042617 Unclassified 2834
36 Ga0466718_042183 3300042617 Bacteria 62729
37 Ga0466718_154028 3300042617 Unclassified 1021
38 Ga0123353_10077395 3300010167 Bacteria 5345
39 Ga0466692_150410 3300042591 Bacteria 17592
40 Ga0466699_006552 3300042597 Bacteria 1377
41 Ga0466701_015337 3300042598 Bacteria 1458
42 Ga0466720_022852 3300042607 Bacteria 5742
43 Ga0466720_166038 3300042607 Bacteria 2799
44 Ga0466698_468993 3300042610 Bacteria 1772
45 Ga0466731_346130 3300042622 Unclassified 1356
46 AustNasuHG_c1013888 3300000089 Unclassified 2751
47 JGI24698J34947_10003554 3300002449 Bacteria 8464
48 JGI24698J34947_10046807 3300002449 Unclassified 2199
49 JGI24695J34938_10031659 3300002450 Archaea 2451
50 Ga0072941_1018465 3300005201 Bacteria 27703
51 Ga0072941_1046601 3300005201 Bacteria 2785
52 Ga0072941_1055187 3300005201 Unclassified 4223
53 Ga0072941_1076774 3300005201 Bacteria 1722
54 Ga0466712_091910 3300042614 Bacteria 39871
55 Ga0466712_093007 3300042614 Bacteria 17888
56 Ga0466728_234327 3300042620 Bacteria 5449
57 Ga0466729_113772 3300042621 Bacteria 2250
58 Ga0123356_10003055 3300010049 Bacteria 17683
59 Ga0264413_117241 3300024493 Unclassified 2351
60 Ga0415639_017387 3300038395 Unclassified 1487
61 Ga0466692_065484 3300042591 Bacteria 3819
62 Ga0466695_098810 3300042595 Unclassified 1030
63 Ga0466706_185910 3300042599 Unclassified 1178
64 Ga0466720_118153 3300042607 Unclassified 1041
65 AustNasuHG_c1028069 3300000089 Bacteria 1693
66 JGI24698J34947_10000008 3300002449 Bacteria 53028
67 JGI24698J34947_10000821 3300002449 Bacteria 15504
68 JGI24698J34947_10011930 3300002449 Bacteria 4771
69 JGI24698J34947_10056321 3300002449 Bacteria 1955
70 Ga0072941_1007821 3300005201 Unclassified 1474
71 Ga0072941_1055186 3300005201 Bacteria 5173
72 Ga0466718_007170 3300042617 Bacteria 1008
73 Ga0466726_177271 3300042619 Bacteria 4122
74 Ga0466692_136612 3300042591 Bacteria 7984
75 Ga0466691_119997 3300042593 Bacteria 11740
76 Ga0466694_404110 3300042594 Bacteria 6339
77 Ga0466699_433170 3300042597 Bacteria 1931
78 Ga0466722_256014 3300042609 Bacteria 6374
79 Ga0466702_194664 3300042635 Unclassified 1611
80 AustNasuHG_c1002764 3300000089 Bacteria 6329
81 AustNasuHG_c1011115 3300000089 Bacteria 3123
82 JGI24698J34947_10014268 3300002449 Bacteria 4327
83 JGI24698J34947_10017878 3300002449 Bacteria 3839
84 JGI24698J34947_10029421 3300002449 Unclassified 2901
85 JGI24695J34938_10130344 3300002450 Unclassified 1025
86 JGI24702J35022_10011218 3300002462 Bacteria 4994
87 Ga0072940_1056524 3300005200 Unclassified 2211
88 Ga0072941_1006645 3300005201 Bacteria 22563
89 Ga0072941_1007822 3300005201 Unclassified 3599
90 Ga0072941_1013847 3300005201 Unclassified 652
91 Ga0466718_151432 3300042617 Bacteria 3942
92 Ga0466728_299807 3300042620 Bacteria 9411
93 Ga0123356_12947471 3300010049 Unclassified 595
94 Ga0255786_1031466 3300022815 Unclassified 704
95 Ga0466690_057741 3300042590 Bacteria 6519
96 Ga0466692_107421 3300042591 Bacteria 7431
97 Ga0466694_034044 3300042594 Unclassified 1827
98 Ga0466699_005735 3300042597 Bacteria 1373
99 Ga0466699_086680 3300042597 Bacteria 5147
100 Ga0466716_115784 3300042605 Bacteria 19907
101 Ga0466704_217340 3300042643 Bacteria 8151
102 JGI24698J34947_10012695 3300002449 Bacteria 4613
103 JGI24698J34947_10136857 3300002449 Unclassified 1038
104 JGI24695J34938_10008810 3300002450 Bacteria 5711
105 JGI24699J35502_11120384 3300002509 Bacteria 3247
106 JGI24696J40584_12899163 3300002834 Bacteria 1175
107 Ga0074263_114065 3300005485 Bacteria 1355
108 Ga0466712_105705 3300042614 Unclassified 4166
109 Ga0466712_159242 3300042614 Bacteria 52985
110 Ga0466712_294839 3300042614 Unclassified 5224
111 Ga0466718_066653 3300042617 Unclassified 1177
112 Ga0466728_246773 3300042620 Bacteria 8300
113 Ga0123357_10304103 3300009784 Bacteria 1605
114 Ga0123355_10009203 3300009826 Bacteria 14990
115 Ga0123356_10341596 3300010049 Unclassified 1618
116 Ga0123356_10672172 3300010049 Unclassified 1203
117 Ga0123356_12032082 3300010049 Unclassified 717
118 Ga0264413_131073 3300024493 Unclassified 1819
119 Ga0466694_009362 3300042594 Bacteria 28493
120 Ga0466695_348049 3300042595 Bacteria 1740
121 Ga0466699_009307 3300042597 Bacteria 35411
122 Ga0466720_076706 3300042607 Unclassified 3562
123 Ga0466720_123923 3300042607 Bacteria 34590
124 Ga0466698_021667 3300042610 Unclassified 2123
125 Ga0466698_166277 3300042610 Bacteria 1704
126 FAAS_10635250 3300001880 Unclassified 502
127 JGI24698J34947_10001653 3300002449 Bacteria 11877
128 JGI24698J34947_10022278 3300002449 Bacteria 3400
129 Ga0072941_1007823 3300005201 Bacteria 2094
130 Ga0074263_102274 3300005485 Bacteria 6941
131 Ga0466733_188004 3300042659 Bacteria 1231
132 Ga0466712_038723 3300042614 Unclassified 3230
133 Ga0466712_067970 3300042614 Bacteria 16434
134 Ga0466712_149716 3300042614 Bacteria 20358
135 Ga0466718_028236 3300042617 Bacteria 32464
136 Ga0466718_048888 3300042617 Unclassified 13659
137 Ga0466718_064365 3300042617 Bacteria 11160
138 Ga0123353_10065931 3300010167 Bacteria 5812
139 Ga0415639_071014 3300038395 Unclassified 3970
140 Ga0466694_129696 3300042594 Bacteria 2149
141 Ga0466720_015742 3300042607 Bacteria 17121
142 Ga0466722_147416 3300042609 Bacteria 6550
143 Ga0466729_200066 3300042621 Bacteria 1056
144 Ga0466704_385213 3300042643 Unclassified 2448
145 AustNasuHG_c1001065 3300000089 Bacteria 9863
146 AustNasuHG_c1020888 3300000089 Bacteria 2126
147 FAAS_10587808 3300001880 Unclassified 549
148 JGI24698J34947_10022642 3300002449 Bacteria 3366
149 JGI24698J34947_10080745 3300002449 Unclassified 1527
150 JGI24695J34938_10049310 3300002450 Bacteria 1851
151 JGI24705J35276_12051465 3300002504 Bacteria 919
152 Ga0072941_1030565 3300005201 Bacteria 2768

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005200 Ga0072940_1056524 Ga0072940_10565243 133
2 3300042591 Ga0466692_150410 Ga0466692_150410_314_715 133
3 3300042614 Ga0466712_142301 Ga0466712_142301_13363_13764 133
4 3300042635 Ga0466702_194664 Ga0466702_194664_527_928 133
5 3300042607 Ga0466720_105696 Ga0466720_105696_1618_2022 134
6 3300042617 Ga0466718_094439 Ga0466718_094439_4442_4849 135
7 3300024493 Ga0264413_131073 Ga0264413_1310733 136
8 3300042617 Ga0466718_042183 Ga0466718_042183_35511_35966 136
9 3300022815 Ga0255786_1031466 Ga0255786_10314662 137
10 3300042597 Ga0466699_005735 Ga0466699_005735_78_491 137
11 3300042597 Ga0466699_086680 Ga0466699_086680_2948_3361 137
12 3300042597 Ga0466699_316478 Ga0466699_316478_1241_1654 137
13 3300042607 Ga0466720_015742 Ga0466720_015742_9274_9687 137
14 3300042607 Ga0466720_123923 Ga0466720_123923_21058_21471 137
15 3300042614 Ga0466712_159242 Ga0466712_159242_49663_50076 137
16 3300042617 Ga0466718_005689 Ga0466718_005689_1552_1965 137
17 3300042617 Ga0466718_066653 Ga0466718_066653_163_576 137
18 3300042617 Ga0466718_151432 Ga0466718_151432_1821_2234 137
19 3300042619 Ga0466726_177271 Ga0466726_177271_353_766 137
20 3300042621 Ga0466729_200066 Ga0466729_200066_458_871 137
21 3300042659 Ga0466733_188004 Ga0466733_188004_507_920 137
22 iso_pr_bacteria 2781125656 2781320106 137
23 iso_pr_bacteria 2781125693 2781434209 137
24 iso_pr_bacteria 2781125695 2781438856 137
25 3300000089 AustNasuHG_c1013888 AustNasuHG_10138882 138
26 3300002450 JGI24695J34938_10031659 JGI24695J34938_100316592 138
27 3300002450 JGI24695J34938_10130344 JGI24695J34938_101303443 138
28 3300002462 JGI24702J35022_10011218 JGI24702J35022_100112183 138
29 3300002509 JGI24699J35502_11120384 JGI24699J35502_111203844 138
30 3300009826 Ga0123355_10009203 Ga0123355_100092039 138
31 3300010049 Ga0123356_10341596 Ga0123356_103415962 138
32 3300010049 Ga0123356_10672172 Ga0123356_106721722 138
33 3300010049 Ga0123356_12032082 Ga0123356_120320821 138
34 3300024493 Ga0264413_117241 Ga0264413_1172413 138
35 3300042590 Ga0466690_057741 Ga0466690_057741_3362_3778 138
36 3300042591 Ga0466692_065484 Ga0466692_065484_311_727 138
37 3300042591 Ga0466692_136612 Ga0466692_136612_3615_4031 138
38 3300042593 Ga0466691_119997 Ga0466691_119997_3324_3740 138
39 3300042594 Ga0466694_129696 Ga0466694_129696_20_436 138
40 3300042595 Ga0466695_098810 Ga0466695_098810_409_825 138
41 3300042597 Ga0466699_023620 Ga0466699_023620_2770_3186 138
42 3300042597 Ga0466699_433170 Ga0466699_433170_638_1054 138
43 3300042600 Ga0466700_046389 Ga0466700_046389_6781_7197 138
44 3300042605 Ga0466716_040936 Ga0466716_040936_1831_2247 138
45 3300042605 Ga0466716_115784 Ga0466716_115784_13897_14313 138
46 3300042614 Ga0466712_091910 Ga0466712_091910_33148_33564 138
47 3300042614 Ga0466712_093007 Ga0466712_093007_5225_5641 138
48 3300042614 Ga0466712_294839 Ga0466712_294839_2663_3079 138
49 3300042617 Ga0466718_028236 Ga0466718_028236_16160_16576 138
50 3300042617 Ga0466718_048888 Ga0466718_048888_9293_9709 138
51 3300042617 Ga0466718_064365 Ga0466718_064365_4431_4847 138
52 3300042620 Ga0466728_234327 Ga0466728_234327_4073_4489 138
53 3300042620 Ga0466728_246773 Ga0466728_246773_5081_5497 138
54 3300042620 Ga0466728_299807 Ga0466728_299807_3036_3452 138
55 3300042622 Ga0466731_018351 Ga0466731_018351_1599_2015 138
56 3300042622 Ga0466731_346130 Ga0466731_346130_179_595 138
57 3300042636 Ga0466703_073711 Ga0466703_073711_4927_5343 138
58 3300042643 Ga0466704_217340 Ga0466704_217340_3601_4017 138
59 3300042659 Ga0466733_145737 Ga0466733_145737_247_663 138
60 iso_pr_bacteria 2781125659 2781327406 138
61 3300000089 AustNasuHG_c1002764 AustNasuHG_10027643 139
62 3300000089 AustNasuHG_c1011115 AustNasuHG_10111152 139
63 3300000089 AustNasuHG_c1020888 AustNasuHG_10208882 139
64 3300000089 AustNasuHG_c1024788 AustNasuHG_10247882 139
65 3300000089 AustNasuHG_c1028069 AustNasuHG_10280692 139
66 3300001880 FAAS_10003252 FAAS_100032523 139
67 3300001880 FAAS_10587808 FAAS_105878081 139
68 3300001880 FAAS_10635250 FAAS_106352502 139
69 3300002449 JGI24698J34947_10000008 JGI24698J34947_1000000815 139
70 3300002449 JGI24698J34947_10012695 JGI24698J34947_100126952 139
71 3300002449 JGI24698J34947_10020297 JGI24698J34947_100202974 139
72 3300002449 JGI24698J34947_10022278 JGI24698J34947_100222783 139
73 3300002449 JGI24698J34947_10022642 JGI24698J34947_100226425 139
74 3300002449 JGI24698J34947_10029421 JGI24698J34947_100294212 139
75 3300002834 JGI24696J40584_12899163 JGI24696J40584_128991632 139
76 3300005201 Ga0072941_1006645 Ga0072941_100664512 139
77 3300005201 Ga0072941_1013847 Ga0072941_10138472 139
78 3300005201 Ga0072941_1030565 Ga0072941_10305652 139
79 3300005201 Ga0072941_1046601 Ga0072941_10466014 139
80 3300005201 Ga0072941_1076774 Ga0072941_10767743 139
81 3300005201 Ga0072941_1080852 Ga0072941_10808522 139
82 3300005485 Ga0074263_102274 Ga0074263_1022744 139
83 3300009784 Ga0123357_10304103 Ga0123357_103041032 139
84 3300010049 Ga0123356_10003055 Ga0123356_1000305521 139
85 3300010049 Ga0123356_12947471 Ga0123356_129474712 139
86 3300038395 Ga0415639_071014 Ga0415639_071014_373_792 139
87 3300042594 Ga0466694_034044 Ga0466694_034044_550_969 139
88 3300042598 Ga0466701_015337 Ga0466701_015337_583_1002 139
89 3300042607 Ga0466720_118153 Ga0466720_118153_546_965 139
90 3300042607 Ga0466720_166038 Ga0466720_166038_1265_1684 139
91 3300042612 Ga0466705_074942 Ga0466705_074942_5970_6389 139
92 3300042614 Ga0466712_067970 Ga0466712_067970_1924_2343 139
93 3300042621 Ga0466729_113772 Ga0466729_113772_1189_1608 139
94 3300042643 Ga0466704_385213 Ga0466704_385213_680_1099 139
95 3300002449 JGI24698J34947_10014065 JGI24698J34947_100140652 140
96 3300002449 JGI24698J34947_10014268 JGI24698J34947_100142685 140
97 3300002450 JGI24695J34938_10008810 JGI24695J34938_100088107 140
98 3300002450 JGI24695J34938_10049310 JGI24695J34938_100493102 140
99 3300002450 JGI24695J34938_10049924 JGI24695J34938_100499243 140
100 3300002504 JGI24705J35276_12051465 JGI24705J35276_120514651 140
101 3300002504 JGI24705J35276_12209653 JGI24705J35276_122096533 140
102 3300005201 Ga0072941_1005276 Ga0072941_10052764 140
103 3300005201 Ga0072941_1012930 Ga0072941_10129306 140
104 3300005201 Ga0072941_1012931 Ga0072941_10129314 140
105 3300005485 Ga0074263_114065 Ga0074263_1140652 140
106 3300010049 Ga0123356_10396662 Ga0123356_103966623 140
107 3300010167 Ga0123353_10077395 Ga0123353_100773953 140
108 3300042591 Ga0466692_107421 Ga0466692_107421_1136_1558 140
109 3300042591 Ga0466692_117010 Ga0466692_117010_348_770 140
110 3300042594 Ga0466694_009362 Ga0466694_009362_24394_24816 140
111 3300042595 Ga0466695_348049 Ga0466695_348049_1288_1710 140
112 3300042607 Ga0466720_022852 Ga0466720_022852_2341_2763 140
113 3300042607 Ga0466720_133387 Ga0466720_133387_1219_1641 140
114 3300042609 Ga0466722_256014 Ga0466722_256014_5673_6095 140
115 3300042617 Ga0466718_007170 Ga0466718_007170_263_685 140
116 3300002449 JGI24698J34947_10136857 JGI24698J34947_101368571 141
117 3300010167 Ga0123353_10040284 Ga0123353_100402847 141
118 3300042594 Ga0466694_246529 Ga0466694_246529_1974_2399 141
119 3300042594 Ga0466694_288050 Ga0466694_288050_17606_18031 141
120 3300042599 Ga0466706_185910 Ga0466706_185910_402_827 141
121 3300042607 Ga0466720_076706 Ga0466720_076706_2971_3396 141
122 3300042614 Ga0466712_038723 Ga0466712_038723_870_1295 141
123 3300042614 Ga0466712_105705 Ga0466712_105705_1958_2383 141
124 3300042614 Ga0466712_149716 Ga0466712_149716_8163_8588 141
125 3300042614 Ga0466712_156915 Ga0466712_156915_9699_10124 141
126 3300042617 Ga0466718_154028 Ga0466718_154028_57_482 141
127 3300002449 JGI24698J34947_10000821 JGI24698J34947_1000082112 142
128 3300002449 JGI24698J34947_10001653 JGI24698J34947_1000165310 142
129 3300002449 JGI24698J34947_10003554 JGI24698J34947_100035544 142
130 3300002449 JGI24698J34947_10011930 JGI24698J34947_100119304 142
131 3300002449 JGI24698J34947_10012663 JGI24698J34947_100126632 142
132 3300002449 JGI24698J34947_10017878 JGI24698J34947_100178785 142
133 3300002449 JGI24698J34947_10046807 JGI24698J34947_100468072 142
134 3300002449 JGI24698J34947_10056321 JGI24698J34947_100563212 142
135 3300002449 JGI24698J34947_10080745 JGI24698J34947_100807452 142
136 3300002509 JGI24699J35502_11129138 JGI24699J35502_111291385 142
137 3300005201 Ga0072941_1007822 Ga0072941_10078222 142
138 3300005201 Ga0072941_1007823 Ga0072941_10078232 142
139 3300005201 Ga0072941_1018465 Ga0072941_101846531 142
140 3300005201 Ga0072941_1050434 Ga0072941_10504342 142
141 3300010167 Ga0123353_12695632 Ga0123353_126956322 142
142 3300042597 Ga0466699_006552 Ga0466699_006552_453_881 142
143 3300042597 Ga0466699_235884 Ga0466699_235884_395_823 142
144 3300042610 Ga0466698_166277 Ga0466698_166277_456_884 142
145 3300005201 Ga0072941_1007821 Ga0072941_10078213 143
146 3300005201 Ga0072941_1055186 Ga0072941_10551862 143
147 3300005201 Ga0072941_1055187 Ga0072941_10551872 143
148 3300042609 Ga0466722_147416 Ga0466722_147416_1376_1807 143
149 iso_pr_bacteria 2781125655 2781318462 143
150 3300000089 AustNasuHG_c1001065 AustNasuHG_10010652 144
151 3300009826 Ga0123355_10006065 Ga0123355_100060658 144
152 3300010167 Ga0123353_10065931 Ga0123353_100659315 144
153 3300042610 Ga0466698_021667 Ga0466698_021667_1671_2108 145
154 3300042610 Ga0466698_468993 Ga0466698_468993_984_1421 145
155 3300042594 Ga0466694_404110 Ga0466694_404110_50_520 156
156 3300042597 Ga0466699_009307 Ga0466699_009307_17229_17711 160
157 3300038395 Ga0415639_017387 Ga0415639_017387_211_741 176

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01850 PIN PIN domain 5 123 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.