Protein Family IF05257

Metagenome Isolate
183 Members
71 Samples
170 Scaffolds
317.07 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_495929|Ga0466696_495929_1440_2699
Length
372 aa
Sequence
MDISIVVPVYNEEESLKELTIWISKVMKYYRYAYEIIMVDDGSVDNSWNVISGISQKNSNVKGVSFRRNYGKSAALQKGFELASGEVVITMDADLQDSPDEIPELYKMIKYDGYDMVSGWKKKRHDPIHKRWPSKFYNKTVRAFSGIKLHDFNCGLKAYRKDVVKSIEVYGEMHRYIPVIAKWAGFKNIGEKVVNHHARKFGKSKFGMERYFKGYLDLLTISFISRYGRRPMHFFGLIGTLLFLAGFIIAIYLAYQKIANQVYYMTTRPLFYFGLLAMGGFLGELISRNGSDRNRYHLKNNIGFSKSDAMITTNTTLPKERIIIEKTASTSKQKATPIKDKKPAKKAEIELPKNELQEKTVKKGSDANKINE

📊 Sample Types

Isolate 7.1%
Metagenome 92.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.5%
Kalotermitidae 22.2%
Unclassified 9.5%
Drosophilidae 6.3%
Culicidae 6.3%
Armadillidiidae 6.3%
Termopsidae 3.2%
Passalidae 3.2%
Hodotermitidae 1.6%
Bombycidae 1.6%
Rhinotermitidae 1.6%
Hydrophilidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 177
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2898741527 Sphingobacterium sp. xlx-73 Isolate
15 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2896350215 Sphingobacterium sp. xlx-183 Isolate
24 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
32 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
33 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
34 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
35 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
40 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
41 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
42 2896321640 Sphingobacterium sp. xlx-130 Isolate
43 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
44 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
45 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
46 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
51 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
52 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
53 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
54 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
55 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
56 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
57 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
58 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
59 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
60 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
61 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
62 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
63 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
64 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
65 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
66 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
67 2896330536 Sphingobacterium sp. xlx-96 Isolate
68 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
69 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
70 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
71 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_106937 3300042612 Bacteria 16700
2 Ga0466714_150592 3300042603 Bacteria 1998
3 Ga0466719_443035 3300042606 Bacteria 1757
4 Ga0466722_210533 3300042609 Bacteria 7884
5 Ga0466710_105098 3300042613 Bacteria 1624
6 Ga0466715_221281 3300042616 Bacteria 18002
7 Ga0466723_019179 3300042618 Bacteria 6986
8 Ga0466723_115474 3300042618 Bacteria 11407
9 Ga0466723_196550 3300042618 Bacteria 18798
10 Ga0466726_256112 3300042619 Bacteria 1688
11 Ga0160472_100054 3300012839 Bacteria 185362
12 Ga0466693_369443 3300042592 Bacteria 5794
13 Ga0466691_188239 3300042593 Bacteria 6364
14 Ga0466694_142525 3300042594 Bacteria 1109
15 Ga0466695_077574 3300042595 Bacteria 1217
16 Ga0466696_075547 3300042596 Bacteria 9309
17 Ga0466696_495929 3300042596 Bacteria 15308
18 Ga0123357_10252545 3300009784 Bacteria 1883
19 Ga0466731_160395 3300042622 Bacteria 3828
20 Ga0466731_360708 3300042622 Bacteria 6479
21 Ga0466724_27765 3300042649 Bacteria 3727
22 Ga0466724_36289 3300042649 Bacteria 18655
23 Ga0466708_147506 3300042652 Bacteria 8066
24 Ga0466708_422142 3300042652 Bacteria 2570
25 Ga0104045_1004469 3300007085 Bacteria 12175
26 Ga0104045_1022983 3300007085 Unclassified 2528
27 Ga0104045_1076268 3300007085 Bacteria 1713
28 Ga0104048_1024748 3300007143 Bacteria 5907
29 Ga0466733_012964 3300042659 Bacteria 37267
30 Ga0466706_021806 3300042599 Bacteria 11800
31 Ga0466716_322882 3300042605 Bacteria 1566
32 Ga0466719_344560 3300042606 Bacteria 3635
33 Ga0466710_148645 3300042613 Bacteria 1846
34 Ga0466710_458716 3300042613 Bacteria 1834
35 Ga0466723_007363 3300042618 Bacteria 16093
36 Ga0466726_110660 3300042619 Bacteria 5497
37 Ga0466728_199788 3300042620 Bacteria 2958
38 Ga0160453_100001 3300012814 Bacteria 1272344
39 Ga0160469_100004 3300012824 Bacteria 821419
40 Ga0466690_193243 3300042590 Bacteria 3826
41 Ga0466691_016036 3300042593 Unclassified 9794
42 Ga0466691_137298 3300042593 Bacteria 5724
43 Ga0123355_10462727 3300009826 Bacteria 1590
44 Ga0123354_10009285 3300010882 Bacteria 15043
45 Ga0123354_10397505 3300010882 Bacteria 1171
46 Ga0466731_385961 3300042622 Bacteria 2842
47 Ga0466734_093544 3300042623 Bacteria 2464
48 Ga0466703_250283 3300042636 Bacteria 8787
49 Ga0466724_20088 3300042649 Bacteria 4406
50 Ga0466724_39659 3300042649 Unclassified 8930
51 Ga0466724_62265 3300042649 Bacteria 8930
52 Ga0466708_206183 3300042652 Bacteria 28300
53 JGI24702J35022_10001488 3300002462 Bacteria 14544
54 JGI24702J35022_10021409 3300002462 Bacteria 3507
55 Ga0072941_1206338 3300005201 Bacteria 2525
56 Ga0104050_1009799 3300007153 Bacteria 2887
57 Ga0466705_323785 3300042612 Bacteria 10850
58 Ga0466705_359318 3300042612 Bacteria 4684
59 Ga0466733_026941 3300042659 Bacteria 8673
60 Ga0466706_073754 3300042599 Bacteria 6313
61 Ga0466710_232518 3300042613 Bacteria 2120
62 Ga0466715_052065 3300042616 Bacteria 25727
63 Ga0466723_270766 3300042618 Bacteria 18832
64 Ga0466690_366072 3300042590 Bacteria 4072
65 Ga0466694_019064 3300042594 Bacteria 1753
66 Ga0466696_106901 3300042596 Bacteria 16358
67 Ga0466696_143786 3300042596 Bacteria 27943
68 Ga0466696_446157 3300042596 Bacteria 4583
69 Ga0123353_10068914 3300010167 Bacteria 5681
70 Ga0123353_10120456 3300010167 Bacteria 4219
71 Ga0123353_10299088 3300010167 Bacteria 2458
72 Ga0123353_10351776 3300010167 Unclassified 2219
73 Ga0123354_10076740 3300010882 Bacteria 4766
74 Ga0466724_23664 3300042649 Bacteria 3767
75 JGI24705J35276_12226676 3300002504 Bacteria 2890
76 Ga0074308_1117067 3300005307 Bacteria 1056
77 Ga0466732_113503 3300042656 Bacteria 2027
78 Ga0466701_054707 3300042598 Bacteria 2475
79 Ga0466714_074208 3300042603 Bacteria 2154
80 Ga0466714_155108 3300042603 Bacteria 1742
81 Ga0466716_109406 3300042605 Bacteria 1502
82 Ga0466716_399087 3300042605 Bacteria 4204
83 Ga0466719_363227 3300042606 Bacteria 5799
84 Ga0466711_075341 3300042615 Bacteria 8692
85 Ga0466723_066635 3300042618 Bacteria 8230
86 Ga0466723_283671 3300042618 Bacteria 34853
87 Ga0466726_228566 3300042619 Bacteria 4019
88 Ga0466728_187106 3300042620 Bacteria 3819
89 Ga0466728_474971 3300042620 Bacteria 7961
90 Ga0160445_100135 3300012847 Bacteria 64427
91 Ga0160436_1003765 3300012861 Bacteria 3682
92 Ga0466690_083281 3300042590 Bacteria 17372
93 Ga0466690_219853 3300042590 Bacteria 5714
94 Ga0160466_100012 3300012809 Bacteria 390121
95 Ga0160470_100001 3300012813 Bacteria 1272206
96 Ga0466731_202073 3300042622 Bacteria 2252
97 Ga0466703_165189 3300042636 Bacteria 7217
98 JGI24696J40584_12949811 3300002834 Bacteria 2102
99 Ga0104045_1075519 3300007085 Bacteria 1936
100 Ga0466701_021309 3300042598 Bacteria 13403
101 Ga0466701_075777 3300042598 Bacteria 2989
102 Ga0466706_015916 3300042599 Bacteria 2611
103 Ga0466722_160223 3300042609 Bacteria 15399
104 Ga0466710_192829 3300042613 Bacteria 1480
105 Ga0466710_432372 3300042613 Bacteria 2106
106 Ga0466715_113386 3300042616 Bacteria 2308
107 Ga0466728_022802 3300042620 Bacteria 8502
108 Ga0160472_101765 3300012839 Bacteria 5657
109 Ga0466696_345172 3300042596 Bacteria 2009
110 Ga0466699_239853 3300042597 Bacteria 2405
111 Ga0123356_10002911 3300010049 Bacteria 18129
112 Ga0123353_10080363 3300010167 Bacteria 5243
113 Ga0466730_039992 3300042625 Bacteria 1355215
114 Ga0466703_194003 3300042636 Bacteria 5471
115 Ga0466704_596017 3300042643 Bacteria 2954
116 JGI24702J35022_10001651 3300002462 Bacteria 13859
117 Ga0466733_036442 3300042659 Bacteria 4939
118 Ga0466715_287839 3300042616 Bacteria 30667
119 Ga0466728_141273 3300042620 Bacteria 7423
120 Ga0123356_10014048 3300010049 Bacteria 7703
121 Ga0123354_10056953 3300010882 Bacteria 5829
122 Ga0466735_090521 3300042624 Bacteria 1839
123 Ga0466709_225343 3300042648 Bacteria 12952
124 Ga0466724_35467 3300042649 Bacteria 3816
125 Ga0466708_126215 3300042652 Bacteria 3093
126 2227517985 2225789004 Bacteria 3397
127 JGI24696J40584_12942502 3300002834 Bacteria 1743
128 Ga0466733_114625 3300042659 Bacteria 12447
129 Ga0466701_033731 3300042598 Bacteria 5522
130 Ga0466713_025848 3300042602 Bacteria 19465
131 Ga0466713_119808 3300042602 Bacteria 48294
132 Ga0466716_213216 3300042605 Bacteria 4155
133 Ga0466716_270697 3300042605 Bacteria 3704
134 Ga0466720_137061 3300042607 Bacteria 2919
135 Ga0466722_182464 3300042609 Bacteria 2540
136 Ga0466722_188725 3300042609 Bacteria 6202
137 Ga0466698_329469 3300042610 Bacteria 1832
138 Ga0466711_041320 3300042615 Bacteria 4259
139 Ga0160445_105138 3300012847 Bacteria 2271
140 Ga0160443_104338 3300012848 Unclassified 2156
141 Ga0466691_107220 3300042593 Bacteria 9135
142 Ga0123357_10101672 3300009784 Bacteria 3703
143 Ga0123356_10029182 3300010049 Bacteria 5168
144 Ga0123353_10140527 3300010167 Bacteria 3869
145 Ga0123353_10200220 3300010167 Bacteria 3142
146 Ga0466703_050239 3300042636 Bacteria 5585
147 Ga0466709_198532 3300042648 Bacteria 44178
148 Ga0466708_220766 3300042652 Bacteria 3388
149 JGI24702J35022_10186640 3300002462 Bacteria 1181
150 Ga0104050_1033150 3300007153 Unclassified 7414
151 Ga0466732_384183 3300042656 Bacteria 1838
152 Ga0466701_099198 3300042598 Bacteria 111054
153 Ga0466701_100714 3300042598 Bacteria 26015
154 Ga0466722_010442 3300042609 Bacteria 16245
155 Ga0466710_454591 3300042613 Bacteria 3790
156 Ga0466728_349493 3300042620 Bacteria 4604
157 Ga0160444_100121 3300012841 Bacteria 83005
158 Ga0160447_100018 3300012849 Bacteria 260737
159 Ga0466690_077666 3300042590 Bacteria 3595
160 Ga0466690_089615 3300042590 Bacteria 17631
161 Ga0466690_104073 3300042590 Bacteria 10792
162 Ga0123353_10092686 3300010167 Bacteria 4867
163 Ga0123353_10131312 3300010167 Bacteria 4018
164 Ga0123353_10557453 3300010167 Bacteria 1651
165 Ga0466708_039466 3300042652 Bacteria 5604
166 Ga0466708_088711 3300042652 Bacteria 35515
167 IMNBL1DRAFT_c0003642 3300000062 Bacteria 9727
168 JGI24702J35022_10007269 3300002462 Bacteria 6357
169 Ga0104045_1001163 3300007085 Bacteria 14264
170 Ga0104048_1001150 3300007143 Bacteria 4319

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007085 Ga0104045_1022983 Ga0104045_10229831 272
2 3300007143 Ga0104048_1024748 Ga0104048_10247484 290
3 3300007153 Ga0104050_1033150 Ga0104050_10331508 290
4 3300042624 Ga0466735_090521 Ga0466735_090521_918_1790 290
5 3300042616 Ga0466715_113386 Ga0466715_113386_13_891 292
6 3300042620 Ga0466728_187106 Ga0466728_187106_2869_3747 292
7 3300002462 JGI24702J35022_10001651 JGI24702J35022_1000165111 301
8 3300010167 Ga0123353_10351776 Ga0123353_103517762 301
9 3300042613 Ga0466710_192829 Ga0466710_192829_78_1028 302
10 3300042596 Ga0466696_143786 Ga0466696_143786_14497_15447 306
11 3300042623 Ga0466734_093544 Ga0466734_093544_1068_2012 306
12 3300005201 Ga0072941_1206338 Ga0072941_12063383 309
13 3300009784 Ga0123357_10101672 Ga0123357_101016724 309
14 3300042606 Ga0466719_443035 Ga0466719_443035_394_1344 311
15 3300042613 Ga0466710_458716 Ga0466710_458716_207_1142 311
16 3300012847 Ga0160445_105138 Ga0160445_1051382 313
17 3300042599 Ga0466706_073754 Ga0466706_073754_703_1644 313
18 3300042613 Ga0466710_105098 Ga0466710_105098_429_1373 314
19 3300042613 Ga0466710_148645 Ga0466710_148645_744_1688 314
20 3300042603 Ga0466714_155108 Ga0466714_155108_727_1674 315
21 3300042609 Ga0466722_182464 Ga0466722_182464_1027_1974 315
22 3300042612 Ga0466705_106937 Ga0466705_106937_1211_2158 315
23 3300042659 Ga0466733_026941 Ga0466733_026941_916_1863 315
24 3300042590 Ga0466690_083281 Ga0466690_083281_9616_10566 316
25 3300042590 Ga0466690_193243 Ga0466690_193243_1048_1998 316
26 3300042593 Ga0466691_016036 Ga0466691_016036_5772_6722 316
27 3300042593 Ga0466691_137298 Ga0466691_137298_1563_2513 316
28 3300042593 Ga0466691_188239 Ga0466691_188239_663_1613 316
29 3300042596 Ga0466696_106901 Ga0466696_106901_7184_8134 316
30 3300042596 Ga0466696_345172 Ga0466696_345172_256_1206 316
31 3300042598 Ga0466701_099198 Ga0466701_099198_17453_18403 316
32 3300042599 Ga0466706_015916 Ga0466706_015916_295_1296 316
33 3300042603 Ga0466714_074208 Ga0466714_074208_1138_2088 316
34 3300042605 Ga0466716_109406 Ga0466716_109406_54_1004 316
35 3300042605 Ga0466716_213216 Ga0466716_213216_1896_2846 316
36 3300042605 Ga0466716_270697 Ga0466716_270697_2515_3465 316
37 3300042605 Ga0466716_322882 Ga0466716_322882_336_1286 316
38 3300042605 Ga0466716_399087 Ga0466716_399087_1940_2890 316
39 3300042606 Ga0466719_344560 Ga0466719_344560_1355_2305 316
40 3300042606 Ga0466719_363227 Ga0466719_363227_1135_2085 316
41 3300042609 Ga0466722_188725 Ga0466722_188725_4519_5469 316
42 3300042612 Ga0466705_359318 Ga0466705_359318_2850_3800 316
43 3300042615 Ga0466711_041320 Ga0466711_041320_2330_3280 316
44 3300042616 Ga0466715_052065 Ga0466715_052065_4442_5392 316
45 3300042616 Ga0466715_221281 Ga0466715_221281_10851_11801 316
46 3300042616 Ga0466715_287839 Ga0466715_287839_26356_27306 316
47 3300042618 Ga0466723_019179 Ga0466723_019179_1347_2297 316
48 3300042618 Ga0466723_066635 Ga0466723_066635_2292_3242 316
49 3300042618 Ga0466723_115474 Ga0466723_115474_2568_3518 316
50 3300042618 Ga0466723_196550 Ga0466723_196550_9212_10162 316
51 3300042618 Ga0466723_283671 Ga0466723_283671_25350_26300 316
52 3300042619 Ga0466726_110660 Ga0466726_110660_2165_3115 316
53 3300042619 Ga0466726_228566 Ga0466726_228566_570_1520 316
54 3300042619 Ga0466726_256112 Ga0466726_256112_41_991 316
55 3300042620 Ga0466728_022802 Ga0466728_022802_1620_2570 316
56 3300042620 Ga0466728_141273 Ga0466728_141273_1034_1984 316
57 3300042620 Ga0466728_199788 Ga0466728_199788_892_1842 316
58 3300042620 Ga0466728_349493 Ga0466728_349493_1347_2297 316
59 3300042625 Ga0466730_039992 Ga0466730_039992_1036848_1037798 316
60 3300042636 Ga0466703_194003 Ga0466703_194003_928_1878 316
61 3300042643 Ga0466704_596017 Ga0466704_596017_948_1898 316
62 3300042648 Ga0466709_198532 Ga0466709_198532_39165_40115 316
63 3300042649 Ga0466724_27765 Ga0466724_27765_718_1668 316
64 3300042649 Ga0466724_36289 Ga0466724_36289_9776_10726 316
65 3300042649 Ga0466724_39659 Ga0466724_39659_4444_5394 316
66 3300042649 Ga0466724_62265 Ga0466724_62265_4443_5393 316
67 3300042652 Ga0466708_039466 Ga0466708_039466_2854_3804 316
68 3300042652 Ga0466708_088711 Ga0466708_088711_22080_23030 316
69 3300042652 Ga0466708_126215 Ga0466708_126215_1473_2423 316
70 3300042652 Ga0466708_147506 Ga0466708_147506_6626_7576 316
71 3300042652 Ga0466708_220766 Ga0466708_220766_2238_3188 316
72 3300042656 Ga0466732_113503 Ga0466732_113503_115_1065 316
73 3300042656 Ga0466732_384183 Ga0466732_384183_877_1827 316
74 iso_pr_bacteria 2579779088 2582238311 316
75 iso_pr_bacteria 2873776654 2873780586 316
76 iso_pr_bacteria 2896321640 2896322134 316
77 iso_pr_bacteria 2896330536 2896333996 316
78 iso_pr_bacteria 2896350215 2896353534 316
79 iso_pr_bacteria 2898741527 2898743009 316
80 3300002462 JGI24702J35022_10001488 JGI24702J35022_100014884 317
81 3300005307 Ga0074308_1117067 Ga0074308_11170671 317
82 3300007085 Ga0104045_1001163 Ga0104045_100116314 317
83 3300007085 Ga0104045_1004469 Ga0104045_10044697 317
84 3300007085 Ga0104045_1076268 Ga0104045_10762682 317
85 3300007143 Ga0104048_1001150 Ga0104048_10011504 317
86 3300009826 Ga0123355_10462727 Ga0123355_104627272 317
87 3300010049 Ga0123356_10014048 Ga0123356_100140483 317
88 3300010167 Ga0123353_10068914 Ga0123353_100689144 317
89 3300010167 Ga0123353_10120456 Ga0123353_101204564 317
90 3300010882 Ga0123354_10056953 Ga0123354_100569534 317
91 3300012809 Ga0160466_100012 Ga0160466_100012255 317
92 3300012824 Ga0160469_100004 Ga0160469_100004428 317
93 3300012839 Ga0160472_100054 Ga0160472_10005499 317
94 3300012841 Ga0160444_100121 Ga0160444_1001219 317
95 3300012848 Ga0160443_104338 Ga0160443_1043382 317
96 3300042596 Ga0466696_075547 Ga0466696_075547_5400_6353 317
97 3300042596 Ga0466696_446157 Ga0466696_446157_2078_3031 317
98 3300042597 Ga0466699_239853 Ga0466699_239853_1403_2356 317
99 3300042609 Ga0466722_010442 Ga0466722_010442_4430_5383 317
100 3300042636 Ga0466703_050239 Ga0466703_050239_1398_2351 317
101 3300042636 Ga0466703_165189 Ga0466703_165189_4605_5558 317
102 3300042659 Ga0466733_012964 Ga0466733_012964_9988_10941 317
103 3300002504 JGI24705J35276_12226676 JGI24705J35276_122266762 318
104 3300010167 Ga0123353_10131312 Ga0123353_101313124 318
105 3300010167 Ga0123353_10140527 Ga0123353_101405273 318
106 3300010167 Ga0123353_10557453 Ga0123353_105574532 318
107 3300010882 Ga0123354_10076740 Ga0123354_100767401 318
108 3300042590 Ga0466690_077666 Ga0466690_077666_2429_3385 318
109 3300042590 Ga0466690_219853 Ga0466690_219853_2125_3081 318
110 3300042590 Ga0466690_366072 Ga0466690_366072_1004_1960 318
111 3300042593 Ga0466691_107220 Ga0466691_107220_6481_7437 318
112 3300042595 Ga0466695_077574 Ga0466695_077574_32_988 318
113 3300042598 Ga0466701_100714 Ga0466701_100714_4439_5395 318
114 3300042603 Ga0466714_150592 Ga0466714_150592_685_1641 318
115 3300042612 Ga0466705_323785 Ga0466705_323785_3984_4940 318
116 3300042613 Ga0466710_454591 Ga0466710_454591_2359_3315 318
117 3300042618 Ga0466723_007363 Ga0466723_007363_12877_13833 318
118 3300042622 Ga0466731_360708 Ga0466731_360708_4741_5697 318
119 3300042636 Ga0466703_250283 Ga0466703_250283_3425_4381 318
120 3300042649 Ga0466724_20088 Ga0466724_20088_216_1172 318
121 3300042649 Ga0466724_23664 Ga0466724_23664_2239_3195 318
122 3300042649 Ga0466724_35467 Ga0466724_35467_2641_3597 318
123 3300042652 Ga0466708_422142 Ga0466708_422142_487_1443 318
124 3300042659 Ga0466733_114625 Ga0466733_114625_740_1696 318
125 iso_pr_bacteria 2820737921 2820739133 318
126 3300000062 IMNBL1DRAFT_c0003642 IMNBL1DRAFT_00036422 319
127 3300002462 JGI24702J35022_10007269 JGI24702J35022_100072692 319
128 3300002834 JGI24696J40584_12942502 JGI24696J40584_129425022 319
129 3300010167 Ga0123353_10080363 Ga0123353_100803635 319
130 3300010167 Ga0123353_10200220 Ga0123353_102002203 319
131 3300012861 Ga0160436_1003765 Ga0160436_10037653 319
132 3300042592 Ga0466693_369443 Ga0466693_369443_192_1151 319
133 3300042594 Ga0466694_019064 Ga0466694_019064_485_1444 319
134 3300042598 Ga0466701_075777 Ga0466701_075777_50_1009 319
135 3300042607 Ga0466720_137061 Ga0466720_137061_1143_2102 319
136 3300042609 Ga0466722_160223 Ga0466722_160223_3649_4608 319
137 3300042609 Ga0466722_210533 Ga0466722_210533_2401_3360 319
138 3300042610 Ga0466698_329469 Ga0466698_329469_813_1772 319
139 3300042622 Ga0466731_160395 Ga0466731_160395_1430_2389 319
140 3300042622 Ga0466731_202073 Ga0466731_202073_840_1799 319
141 3300042622 Ga0466731_385961 Ga0466731_385961_1779_2738 319
142 3300042652 Ga0466708_206183 Ga0466708_206183_13216_14175 319
143 3300042659 Ga0466733_036442 Ga0466733_036442_1569_2528 319
144 iso_pr_bacteria 2820753519 2820754790 319
145 iso_pr_bacteria 2820755292 2820756782 319
146 iso_pr_bacteria 2820755292 2820757014 319
147 iso_pr_bacteria 2820792843 2820794092 319
148 iso_pr_bacteria 2820795054 2820796598 319
149 3300002462 JGI24702J35022_10021409 JGI24702J35022_100214095 320
150 3300002462 JGI24702J35022_10186640 JGI24702J35022_101866401 320
151 3300002834 JGI24696J40584_12949811 JGI24696J40584_129498113 320
152 3300009784 Ga0123357_10252545 Ga0123357_102525452 320
153 3300010049 Ga0123356_10002911 Ga0123356_1000291126 320
154 3300010049 Ga0123356_10029182 Ga0123356_100291825 320
155 3300010167 Ga0123353_10299088 Ga0123353_102990882 320
156 3300042602 Ga0466713_119808 Ga0466713_119808_23228_24190 320
157 3300010882 Ga0123354_10397505 Ga0123354_103975051 321
158 3300012847 Ga0160445_100135 Ga0160445_10013518 321
159 3300042594 Ga0466694_142525 Ga0466694_142525_87_1052 321
160 3300042598 Ga0466701_033731 Ga0466701_033731_539_1504 321
161 3300042598 Ga0466701_054707 Ga0466701_054707_852_1817 321
162 3300007085 Ga0104045_1075519 Ga0104045_10755191 322
163 3300007153 Ga0104050_1009799 Ga0104050_10097994 322
164 3300010882 Ga0123354_10009285 Ga0123354_100092852 322
165 3300042590 Ga0466690_089615 Ga0466690_089615_16339_17310 323
166 3300042620 Ga0466728_474971 Ga0466728_474971_1054_2025 323
167 3300042618 Ga0466723_270766 Ga0466723_270766_14118_15095 325
168 3300010167 Ga0123353_10092686 Ga0123353_100926864 326
169 3300012813 Ga0160470_100001 Ga0160470_100001356 326
170 3300012814 Ga0160453_100001 Ga0160453_100001356 326
171 3300012839 Ga0160472_101765 Ga0160472_1017654 326
172 3300012849 Ga0160447_100018 Ga0160447_100018208 326
173 3300042598 Ga0466701_021309 Ga0466701_021309_10416_11396 326
174 2225789004 2227517985 2228018544 327
175 3300042599 Ga0466706_021806 Ga0466706_021806_6463_7464 327
176 3300042602 Ga0466713_025848 Ga0466713_025848_11259_12245 328
177 3300042613 Ga0466710_232518 Ga0466710_232518_926_1963 328
178 3300042648 Ga0466709_225343 Ga0466709_225343_580_1566 328
179 3300042613 Ga0466710_432372 Ga0466710_432372_12_1001 329
180 3300042590 Ga0466690_104073 Ga0466690_104073_9621_10613 330
181 3300042615 Ga0466711_075341 Ga0466711_075341_5343_6335 330
182 iso_pr_bacteria 2509276035 2509458208 333
183 3300042596 Ga0466696_495929 Ga0466696_495929_1440_2699 372

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00535 Glycos_transf_2 Glycosyl transferase family 2 4 166 0.94
PF10111 Glyco_tranf_2_2 Glycosyltransferase like family 2 4 110 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.