Protein Family IF05256
Metagenome
Isolate
133
Members
65
Samples
114
Scaffolds
211.68
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_491702|Ga0466696_491702_86_820
- Length
- 244 aa
- Sequence
- MWLENLSWFGSLRIKTVTFSTEAFVGNVCSSGSGMSDTTAWLSSAYLAPVDYYMCLARFDEIIIEQHCNYIKQTYRNRCRIASANGLQVLSIPVERTGSAKCLTKDLRISDHGNWRHLHWNAIVSAYNSTPFFEYYEDDFRPFYERKFEFLFDFNETLRELVCRLIDIEPKISYTSSYGISGDNILNPDSCENDFRELIHPKKNSVHRTFKPYYQVFDSKFGFQSGLSIIDLLFNMGPESILFL
Sample Types
Isolate
14.3%
Metagenome
85.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.3%
Kalotermitidae
21.5%
Unclassified
13.8%
Blattidae
13.8%
Rhinotermitidae
7.7%
Termopsidae
4.6%
Hydrophilidae
3.1%
Hodotermitidae
1.5%
Drosophilidae
1.5%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
1
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 12 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 13 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 20 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 21 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 22 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 23 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 24 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 29 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 30 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 31 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 34 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 35 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 36 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 48 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 55 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 56 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 57 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 58 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 59 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 60 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 61 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 62 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 63 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 64 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 65 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10024510 | 3300002462 | Bacteria | 3259 |
| 2 | Ga0466722_062472 | 3300042609 | Bacteria | 2505 |
| 3 | Ga0123356_11010620 | 3300010049 | Bacteria | 1002 |
| 4 | Ga0123354_10000565 | 3300010882 | Bacteria | 38228 |
| 5 | Ga0466729_049540 | 3300042621 | Bacteria | 2427 |
| 6 | Ga0466695_159436 | 3300042595 | Bacteria | 18608 |
| 7 | Ga0466696_176785 | 3300042596 | Bacteria | 19925 |
| 8 | Ga0466696_502505 | 3300042596 | Bacteria | 3301 |
| 9 | Ga0466734_116528 | 3300042623 | Bacteria | 3470 |
| 10 | Ga0466735_009753 | 3300042624 | Bacteria | 7578 |
| 11 | Ga0466735_200979 | 3300042624 | Bacteria | 5294 |
| 12 | Ga0466727_026681 | 3300042655 | Bacteria | 4518 |
| 13 | Ga0466727_230118 | 3300042655 | Bacteria | 5057 |
| 14 | Ga0466733_172872 | 3300042659 | Unclassified | 6351 |
| 15 | Ga0466706_156084 | 3300042599 | Bacteria | 15343 |
| 16 | Ga0466713_130649 | 3300042602 | Bacteria | 5951 |
| 17 | Ga0123354_10004445 | 3300010882 | Bacteria | 19882 |
| 18 | Ga0466715_572377 | 3300042616 | Bacteria | 2364 |
| 19 | Ga0466657_324794 | 3300042582 | Bacteria | 2607 |
| 20 | Ga0466735_162853 | 3300042624 | Bacteria | 2658 |
| 21 | Ga0466703_209908 | 3300042636 | Bacteria | 15354 |
| 22 | Ga0466703_286565 | 3300042636 | Bacteria | 10843 |
| 23 | Ga0466703_318682 | 3300042636 | Bacteria | 11416 |
| 24 | Ga0466703_318839 | 3300042636 | Bacteria | 3814 |
| 25 | Ga0466709_040085 | 3300042648 | Bacteria | 30054 |
| 26 | Ga0466732_447361 | 3300042656 | Bacteria | 66921 |
| 27 | JGI24702J35022_10025947 | 3300002462 | Bacteria | 3160 |
| 28 | JGI24696J40584_12957299 | 3300002834 | Bacteria | 3447 |
| 29 | Ga0068305_10335350 | 3300005083 | Bacteria | 1077 |
| 30 | Ga0466701_030485 | 3300042598 | Bacteria | 1949 |
| 31 | Ga0466706_020771 | 3300042599 | Bacteria | 15999 |
| 32 | Ga0466706_094996 | 3300042599 | Bacteria | 11890 |
| 33 | Ga0466707_260623 | 3300042601 | Bacteria | 26104 |
| 34 | Ga0466713_037159 | 3300042602 | Bacteria | 5402 |
| 35 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 36 | Ga0466722_073992 | 3300042609 | Bacteria | 7758 |
| 37 | Ga0123353_10405224 | 3300010167 | Bacteria | 2028 |
| 38 | Ga0123354_10681709 | 3300010882 | Unclassified | 724 |
| 39 | Ga0466715_140819 | 3300042616 | Bacteria | 7165 |
| 40 | Ga0466728_139318 | 3300042620 | Bacteria | 53765 |
| 41 | Ga0466728_250639 | 3300042620 | Bacteria | 1345 |
| 42 | Ga0466691_119415 | 3300042593 | Bacteria | 17416 |
| 43 | Ga0466696_088903 | 3300042596 | Bacteria | 11244 |
| 44 | Ga0466696_423060 | 3300042596 | Bacteria | 14772 |
| 45 | Ga0466696_491702 | 3300042596 | Bacteria | 1336 |
| 46 | Ga0466704_309403 | 3300042643 | Bacteria | 34772 |
| 47 | Ga0466732_374762 | 3300042656 | Bacteria | 2825 |
| 48 | Ga0466733_078580 | 3300042659 | Bacteria | 13313 |
| 49 | JGI24696J40584_12920424 | 3300002834 | Bacteria | 1342 |
| 50 | Ga0466706_288954 | 3300042599 | Bacteria | 24469 |
| 51 | Ga0466714_017724 | 3300042603 | Bacteria | 3052 |
| 52 | Ga0466714_120135 | 3300042603 | Bacteria | 12630 |
| 53 | Ga0123356_10240367 | 3300010049 | Bacteria | 1881 |
| 54 | Ga0466711_373454 | 3300042615 | Bacteria | 2212 |
| 55 | Ga0466723_184502 | 3300042618 | Bacteria | 6295 |
| 56 | Ga0466726_016746 | 3300042619 | Bacteria | 3745 |
| 57 | Ga0466728_249094 | 3300042620 | Bacteria | 125538 |
| 58 | Ga0466692_088040 | 3300042591 | Bacteria | 4869 |
| 59 | Ga0466693_190261 | 3300042592 | Bacteria | 1598 |
| 60 | Ga0466696_086524 | 3300042596 | Bacteria | 3435 |
| 61 | Ga0466735_013961 | 3300042624 | Bacteria | 4005 |
| 62 | Ga0466704_259053 | 3300042643 | Bacteria | 5411 |
| 63 | Ga0466705_373818 | 3300042612 | Bacteria | 18025 |
| 64 | Ga0466733_127865 | 3300042659 | Bacteria | 19394 |
| 65 | Ga0104048_1176577 | 3300007143 | Viruses | 979 |
| 66 | Ga0466707_368503 | 3300042601 | Bacteria | 3522 |
| 67 | Ga0466713_059440 | 3300042602 | Bacteria | 68698 |
| 68 | Ga0466714_045701 | 3300042603 | Bacteria | 3613 |
| 69 | Ga0466722_136926 | 3300042609 | Bacteria | 3300 |
| 70 | Ga0466711_428622 | 3300042615 | Bacteria | 45121 |
| 71 | Ga0466690_229678 | 3300042590 | Bacteria | 4764 |
| 72 | Ga0466695_027096 | 3300042595 | Bacteria | 1333 |
| 73 | Ga0466695_034169 | 3300042595 | Bacteria | 2473 |
| 74 | Ga0466696_360518 | 3300042596 | Bacteria | 27145 |
| 75 | Ga0466704_082171 | 3300042643 | Bacteria | 5268 |
| 76 | JGI24705J35276_12201807 | 3300002504 | Bacteria | 1625 |
| 77 | Ga0466700_216950 | 3300042600 | Bacteria | 8275 |
| 78 | Ga0466713_088179 | 3300042602 | Bacteria | 19340 |
| 79 | Ga0466713_125888 | 3300042602 | Bacteria | 191726 |
| 80 | Ga0466716_101121 | 3300042605 | Bacteria | 3506 |
| 81 | Ga0466722_023668 | 3300042609 | Bacteria | 1938 |
| 82 | Ga0466698_292986 | 3300042610 | Bacteria | 1266 |
| 83 | Ga0123357_10532914 | 3300009784 | Bacteria | 950 |
| 84 | Ga0466728_092836 | 3300042620 | Bacteria | 17971 |
| 85 | Ga0466693_134459 | 3300042592 | Bacteria | 1116 |
| 86 | Ga0466735_121244 | 3300042624 | Bacteria | 1795 |
| 87 | Ga0466730_079553 | 3300042625 | Bacteria | 1481 |
| 88 | Ga0466703_262010 | 3300042636 | Bacteria | 2333 |
| 89 | Ga0466708_161327 | 3300042652 | Bacteria | 12977 |
| 90 | Ga0466708_358932 | 3300042652 | Bacteria | 5364 |
| 91 | Ga0466727_223570 | 3300042655 | Bacteria | 3111 |
| 92 | Ga0466705_269715 | 3300042612 | Bacteria | 22152 |
| 93 | Ga0466733_213727 | 3300042659 | Bacteria | 3338 |
| 94 | JGI24696J40584_12961203 | 3300002834 | Bacteria | 11971 |
| 95 | Ga0466706_054201 | 3300042599 | Bacteria | 6950 |
| 96 | Ga0466719_080241 | 3300042606 | Bacteria | 14299 |
| 97 | Ga0466719_286217 | 3300042606 | Bacteria | 2897 |
| 98 | Ga0466722_236248 | 3300042609 | Bacteria | 1569 |
| 99 | Ga0123353_10397654 | 3300010167 | Bacteria | 2052 |
| 100 | Ga0123353_10639620 | 3300010167 | Bacteria | 1509 |
| 101 | Ga0466715_350833 | 3300042616 | Bacteria | 63527 |
| 102 | Ga0466699_284434 | 3300042597 | Unclassified | 1004 |
| 103 | Ga0466729_289416 | 3300042621 | Bacteria | 4139 |
| 104 | Ga0466732_112988 | 3300042656 | Bacteria | 1674 |
| 105 | Ga0466733_111961 | 3300042659 | Bacteria | 105531 |
| 106 | Ga0466701_089291 | 3300042598 | Bacteria | 2135 |
| 107 | Ga0466717_110220 | 3300042604 | Bacteria | 2067 |
| 108 | Ga0123356_11754429 | 3300010049 | Bacteria | 771 |
| 109 | Ga0466715_376224 | 3300042616 | Bacteria | 43713 |
| 110 | Ga0466728_318809 | 3300042620 | Bacteria | 56945 |
| 111 | Ga0466729_154492 | 3300042621 | Bacteria | 1256 |
| 112 | Ga0466693_440650 | 3300042592 | Bacteria | 2017 |
| 113 | Ga0466709_393150 | 3300042648 | Bacteria | 88757 |
| 114 | Ga0466725_355450 | 3300042654 | Bacteria | 39231 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010049 | Ga0123356_11754429 | Ga0123356_117544292 | 186 |
| 2 | 3300042659 | Ga0466733_078580 | Ga0466733_078580_58_642 | 194 |
| 3 | 3300042618 | Ga0466723_184502 | Ga0466723_184502_3637_4230 | 197 |
| 4 | 3300042596 | Ga0466696_502505 | Ga0466696_502505_834_1430 | 198 |
| 5 | 3300042656 | Ga0466732_112988 | Ga0466732_112988_990_1586 | 198 |
| 6 | 3300042609 | Ga0466722_136926 | Ga0466722_136926_1344_1943 | 199 |
| 7 | 3300042636 | Ga0466703_262010 | Ga0466703_262010_194_853 | 199 |
| 8 | 3300042656 | Ga0466732_447361 | Ga0466732_447361_24606_25208 | 200 |
| 9 | 3300002834 | JGI24696J40584_12957299 | JGI24696J40584_129572994 | 201 |
| 10 | 3300042604 | Ga0466717_110220 | Ga0466717_110220_101_706 | 201 |
| 11 | 3300042595 | Ga0466695_027096 | Ga0466695_027096_104_712 | 202 |
| 12 | 3300042643 | Ga0466704_259053 | Ga0466704_259053_3343_3951 | 202 |
| 13 | 3300042599 | Ga0466706_094996 | Ga0466706_094996_7282_7893 | 203 |
| 14 | 3300042602 | Ga0466713_088179 | Ga0466713_088179_2564_3175 | 203 |
| 15 | 3300042606 | Ga0466719_286217 | Ga0466719_286217_1633_2244 | 203 |
| 16 | 3300042616 | Ga0466715_376224 | Ga0466715_376224_4459_5070 | 203 |
| 17 | 3300042636 | Ga0466703_209908 | Ga0466703_209908_8469_9080 | 203 |
| 18 | 3300042655 | Ga0466727_026681 | Ga0466727_026681_2264_2875 | 203 |
| 19 | 3300042655 | Ga0466727_230118 | Ga0466727_230118_4271_4882 | 203 |
| 20 | 3300042599 | Ga0466706_020771 | Ga0466706_020771_15235_15891 | 204 |
| 21 | 3300042599 | Ga0466706_156084 | Ga0466706_156084_11186_11800 | 204 |
| 22 | 3300042609 | Ga0466722_023668 | Ga0466722_023668_217_831 | 204 |
| 23 | 3300042616 | Ga0466715_140819 | Ga0466715_140819_458_1072 | 204 |
| 24 | 3300042624 | Ga0466735_009753 | Ga0466735_009753_2800_3414 | 204 |
| 25 | 3300042615 | Ga0466711_373454 | Ga0466711_373454_1080_1697 | 205 |
| 26 | iso_pr_bacteria | 2910930387 | 2910932858 | 205 |
| 27 | 3300002462 | JGI24702J35022_10025947 | JGI24702J35022_100259474 | 206 |
| 28 | 3300002504 | JGI24705J35276_12201807 | JGI24705J35276_122018072 | 206 |
| 29 | 3300042582 | Ga0466657_324794 | Ga0466657_324794_819_1439 | 206 |
| 30 | 3300042591 | Ga0466692_088040 | Ga0466692_088040_2135_2755 | 206 |
| 31 | 3300042598 | Ga0466701_089291 | Ga0466701_089291_1430_2050 | 206 |
| 32 | 3300042609 | Ga0466722_073992 | Ga0466722_073992_144_764 | 206 |
| 33 | 3300042596 | Ga0466696_176785 | Ga0466696_176785_6883_7506 | 207 |
| 34 | 3300042599 | Ga0466706_288954 | Ga0466706_288954_18309_18932 | 207 |
| 35 | 3300042605 | Ga0466716_101121 | Ga0466716_101121_76_699 | 207 |
| 36 | 3300042609 | Ga0466722_062472 | Ga0466722_062472_1009_1632 | 207 |
| 37 | 3300042619 | Ga0466726_016746 | Ga0466726_016746_1939_2562 | 207 |
| 38 | 3300042620 | Ga0466728_139318 | Ga0466728_139318_40822_41445 | 207 |
| 39 | 3300042623 | Ga0466734_116528 | Ga0466734_116528_2096_2719 | 207 |
| 40 | 3300042624 | Ga0466735_013961 | Ga0466735_013961_2635_3258 | 207 |
| 41 | 3300042648 | Ga0466709_040085 | Ga0466709_040085_4824_5447 | 207 |
| 42 | 3300042655 | Ga0466727_223570 | Ga0466727_223570_1552_2175 | 207 |
| 43 | 3300010049 | Ga0123356_10240367 | Ga0123356_102403672 | 208 |
| 44 | 3300010882 | Ga0123354_10004445 | Ga0123354_100044456 | 208 |
| 45 | 3300042616 | Ga0466715_572377 | Ga0466715_572377_1237_1863 | 208 |
| 46 | 3300042620 | Ga0466728_249094 | Ga0466728_249094_14794_15420 | 208 |
| 47 | 3300042636 | Ga0466703_318839 | Ga0466703_318839_1483_2109 | 208 |
| 48 | 3300042654 | Ga0466725_355450 | Ga0466725_355450_31014_31655 | 208 |
| 49 | iso_pr_bacteria | 2820789850 | 2820790342 | 208 |
| 50 | 3300042597 | Ga0466699_284434 | Ga0466699_284434_271_900 | 209 |
| 51 | 3300042621 | Ga0466729_049540 | Ga0466729_049540_240_869 | 209 |
| 52 | 3300042643 | Ga0466704_082171 | Ga0466704_082171_349_978 | 209 |
| 53 | 3300042659 | Ga0466733_111961 | Ga0466733_111961_10500_11129 | 209 |
| 54 | iso_pr_bacteria | 3004667792 | 3004671918 | 209 |
| 55 | 3300042593 | Ga0466691_119415 | Ga0466691_119415_975_1607 | 210 |
| 56 | 3300042595 | Ga0466695_034169 | Ga0466695_034169_1644_2276 | 210 |
| 57 | 3300042620 | Ga0466728_092836 | Ga0466728_092836_13303_13935 | 210 |
| 58 | 3300042620 | Ga0466728_250639 | Ga0466728_250639_41_673 | 210 |
| 59 | iso_pr_bacteria | 2695420314 | 2695473641 | 210 |
| 60 | 3300009784 | Ga0123357_10532914 | Ga0123357_105329141 | 211 |
| 61 | 3300042598 | Ga0466701_030485 | Ga0466701_030485_175_810 | 211 |
| 62 | 3300042600 | Ga0466700_216950 | Ga0466700_216950_1353_2021 | 211 |
| 63 | 3300042612 | Ga0466705_269715 | Ga0466705_269715_21419_22054 | 211 |
| 64 | 3300042625 | Ga0466730_079553 | Ga0466730_079553_393_1028 | 211 |
| 65 | iso_pr_bacteria | 2873600114 | 2873601549 | 211 |
| 66 | iso_pr_bacteria | 2873610414 | 2873611902 | 211 |
| 67 | iso_pr_bacteria | 2910959314 | 2910961172 | 211 |
| 68 | 3300010167 | Ga0123353_10405224 | Ga0123353_104052243 | 212 |
| 69 | 3300010167 | Ga0123353_10639620 | Ga0123353_106396202 | 212 |
| 70 | 3300010882 | Ga0123354_10000565 | Ga0123354_100005658 | 212 |
| 71 | 3300042603 | Ga0466714_017724 | Ga0466714_017724_1763_2401 | 212 |
| 72 | 3300042609 | Ga0466722_236248 | Ga0466722_236248_15_653 | 212 |
| 73 | iso_pr_bacteria | 2922326829 | 2922327460 | 212 |
| 74 | 3300042596 | Ga0466696_086524 | Ga0466696_086524_1668_2309 | 213 |
| 75 | 3300042602 | Ga0466713_096596 | Ga0466713_096596_28178_28819 | 213 |
| 76 | 3300042606 | Ga0466719_080241 | Ga0466719_080241_6541_7182 | 213 |
| 77 | 3300042610 | Ga0466698_292986 | Ga0466698_292986_47_688 | 213 |
| 78 | 3300042612 | Ga0466705_373818 | Ga0466705_373818_9571_10212 | 213 |
| 79 | 3300042621 | Ga0466729_289416 | Ga0466729_289416_333_974 | 213 |
| 80 | 3300042643 | Ga0466704_309403 | Ga0466704_309403_11945_12586 | 213 |
| 81 | 3300042652 | Ga0466708_161327 | Ga0466708_161327_637_1278 | 213 |
| 82 | 3300042652 | Ga0466708_358932 | Ga0466708_358932_1483_2124 | 213 |
| 83 | 3300042659 | Ga0466733_213727 | Ga0466733_213727_866_1507 | 213 |
| 84 | 3300002462 | JGI24702J35022_10024510 | JGI24702J35022_100245103 | 214 |
| 85 | 3300042595 | Ga0466695_159436 | Ga0466695_159436_1015_1689 | 214 |
| 86 | 3300042603 | Ga0466714_045701 | Ga0466714_045701_1509_2153 | 214 |
| 87 | iso_pr_bacteria | 2695420931 | 2698112143 | 214 |
| 88 | iso_pr_bacteria | 2910926975 | 2910929732 | 214 |
| 89 | 3300042602 | Ga0466713_037159 | Ga0466713_037159_581_1228 | 215 |
| 90 | 3300042602 | Ga0466713_130649 | Ga0466713_130649_3271_3918 | 215 |
| 91 | 3300042624 | Ga0466735_162853 | Ga0466735_162853_1461_2123 | 215 |
| 92 | 3300042624 | Ga0466735_200979 | Ga0466735_200979_4625_5272 | 215 |
| 93 | iso_pr_bacteria | 2940244548 | 2940248250 | 215 |
| 94 | iso_pr_bacteria | 2940248789 | 2940252425 | 215 |
| 95 | iso_pr_bacteria | 2940253009 | 2940256589 | 215 |
| 96 | iso_pr_bacteria | 2940257232 | 2940260741 | 215 |
| 97 | iso_pr_bacteria | 2967483437 | 2967486824 | 215 |
| 98 | 3300010167 | Ga0123353_10397654 | Ga0123353_103976541 | 216 |
| 99 | 3300042599 | Ga0466706_054201 | Ga0466706_054201_85_735 | 216 |
| 100 | 3300042620 | Ga0466728_318809 | Ga0466728_318809_17233_17883 | 216 |
| 101 | 3300042659 | Ga0466733_127865 | Ga0466733_127865_13225_13875 | 216 |
| 102 | 3300042602 | Ga0466713_125888 | Ga0466713_125888_250_903 | 217 |
| 103 | 3300042616 | Ga0466715_350833 | Ga0466715_350833_62494_63147 | 217 |
| 104 | 3300042621 | Ga0466729_154492 | Ga0466729_154492_541_1194 | 217 |
| 105 | 3300042648 | Ga0466709_393150 | Ga0466709_393150_87731_88384 | 217 |
| 106 | 3300042656 | Ga0466732_374762 | Ga0466732_374762_2024_2677 | 217 |
| 107 | 3300042659 | Ga0466733_172872 | Ga0466733_172872_1343_1996 | 217 |
| 108 | iso_pr_bacteria | 2695420317 | 2695483347 | 217 |
| 109 | iso_pr_bacteria | 8100157865 | 8100159355 | 217 |
| 110 | iso_pr_bacteria | 8100166142 | 8100169303 | 217 |
| 111 | 3300005083 | Ga0068305_10335350 | Ga0068305_103353502 | 218 |
| 112 | 3300007143 | Ga0104048_1176577 | Ga0104048_11765771 | 218 |
| 113 | 3300010882 | Ga0123354_10681709 | Ga0123354_106817091 | 218 |
| 114 | 3300042592 | Ga0466693_190261 | Ga0466693_190261_435_1091 | 218 |
| 115 | iso_pr_bacteria | 2830041218 | 2830043102 | 218 |
| 116 | 3300002834 | JGI24696J40584_12920424 | JGI24696J40584_129204241 | 219 |
| 117 | 3300010049 | Ga0123356_11010620 | Ga0123356_110106202 | 219 |
| 118 | 3300042592 | Ga0466693_440650 | Ga0466693_440650_600_1259 | 219 |
| 119 | 3300042601 | Ga0466707_368503 | Ga0466707_368503_135_797 | 220 |
| 120 | 3300042615 | Ga0466711_428622 | Ga0466711_428622_345_1007 | 220 |
| 121 | 3300042636 | Ga0466703_286565 | Ga0466703_286565_9909_10571 | 220 |
| 122 | 3300002834 | JGI24696J40584_12961203 | JGI24696J40584_129612036 | 221 |
| 123 | 3300042596 | Ga0466696_360518 | Ga0466696_360518_6221_6886 | 221 |
| 124 | 3300042596 | Ga0466696_423060 | Ga0466696_423060_9151_9816 | 221 |
| 125 | 3300042590 | Ga0466690_229678 | Ga0466690_229678_3087_3761 | 224 |
| 126 | 3300042596 | Ga0466696_088903 | Ga0466696_088903_6186_6860 | 224 |
| 127 | 3300042592 | Ga0466693_134459 | Ga0466693_134459_364_1044 | 226 |
| 128 | 3300042624 | Ga0466735_121244 | Ga0466735_121244_367_1053 | 228 |
| 129 | 3300042636 | Ga0466703_318682 | Ga0466703_318682_3134_3832 | 232 |
| 130 | 3300042601 | Ga0466707_260623 | Ga0466707_260623_6664_7368 | 234 |
| 131 | 3300042602 | Ga0466713_059440 | Ga0466713_059440_29703_30407 | 234 |
| 132 | 3300042603 | Ga0466714_120135 | Ga0466714_120135_2061_2786 | 241 |
| 133 | 3300042596 | Ga0466696_491702 | Ga0466696_491702_86_820 | 244 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08889 | WbqC | WbqC-like protein family | 45 | 184 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.79 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.