Protein Family IF05252

Metagenome Isolate
149 Members
61 Samples
129 Scaffolds
253.5 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_460040|Ga0466696_460040_1039_1848
Length
269 aa
Sequence
MRLDSFVNFKILEDMELTDIIKPDNLVYGKPELMNNNPMHYCPGCSHGVIHKLIAEVIADMGMEEQTVGVSPVGCAVFAYNYLDIDWVEAAHGRAPAVATALKRLNRDKMVFTYQGDGDLAAIGTAETIHAANRGENIVIVFVNNAIYGMTGGQMAPTTLEGMPTSTCPYGRDVELNGYPLKISDLLAALEGTCYVTRQSVHTASAVRKAKKSLRKAFENSMTTGKGTSVVEFVSTCSSGWKMTPGRANTWMEEHMFPFYPLGDIKNVE

📊 Sample Types

Isolate 13.4%
Metagenome 86.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 32.2%
Kalotermitidae 23.7%
Termitidae 23.7%
Unclassified 6.8%
Rhinotermitidae 5.1%
Passalidae 3.4%
Termopsidae 3.4%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
7 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
8 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
9 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
10 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
11 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
15 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
18 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
19 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
20 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
21 3004672520 Bacteroides sp. 51 Isolate Blattidae
22 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
23 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
24 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
25 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
26 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
28 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
29 3004677695 Bacteroides sp. 214 Isolate Blattidae
30 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
31 2923982719 Parabacteroides sp. 52 Isolate Blattidae
32 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
33 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
34 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
37 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
38 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
39 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
40 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
41 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
42 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
43 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
44 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
50 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
51 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
52 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
53 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
54 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
55 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
56 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
57 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
58 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
59 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
60 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
61 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_152618 3300042612 Bacteria 16804
2 Ga0466733_029904 3300042659 Bacteria 2239
3 Ga0466711_021252 3300042615 Bacteria 8622
4 Ga0466690_419789 3300042590 Bacteria 20681
5 Ga0466696_054052 3300042596 Bacteria 3711
6 Ga0466696_248480 3300042596 Bacteria 8299
7 Ga0466731_424101 3300042622 Bacteria 3436
8 Ga0466704_044961 3300042643 Bacteria 2873
9 Ga0466707_414711 3300042601 Bacteria 12149
10 Ga0466716_068984 3300042605 Bacteria 6876
11 Ga0466719_206576 3300042606 Bacteria 9122
12 Ga0466722_166869 3300042609 Bacteria 6947
13 Ga0466711_123903 3300042615 Bacteria 10875
14 Ga0466711_288717 3300042615 Bacteria 5493
15 Ga0466715_184077 3300042616 Bacteria 7041
16 Ga0466715_323248 3300042616 Bacteria 7339
17 Ga0466728_011534 3300042620 Bacteria 28821
18 Ga0466696_141833 3300042596 Bacteria 18307
19 Ga0466696_168764 3300042596 Bacteria 12119
20 Ga0466729_304089 3300042621 Bacteria 3988
21 Ga0466734_060110 3300042623 Bacteria 1901
22 Ga0466707_010317 3300042601 Bacteria 15926
23 Ga0466719_433192 3300042606 Bacteria 5396
24 JGI24702J35022_10000131 3300002462 Bacteria 37210
25 JGI24699J35502_11134162 3300002509 Bacteria 41397
26 Ga0072941_1187421 3300005201 Bacteria 3125
27 Ga0466711_286714 3300042615 Bacteria 23462
28 Ga0466715_255387 3300042616 Bacteria 2893
29 Ga0466715_429111 3300042616 Bacteria 6362
30 Ga0466723_095121 3300042618 Bacteria 177949
31 Ga0466723_136332 3300042618 Bacteria 15291
32 Ga0466723_182664 3300042618 Bacteria 13551
33 Ga0466690_213523 3300042590 Bacteria 18139
34 Ga0466692_001194 3300042591 Bacteria 22639
35 Ga0466691_029267 3300042593 Bacteria 26342
36 Ga0466703_046877 3300042636 Bacteria 5027
37 Ga0466703_048877 3300042636 Bacteria 2674
38 Ga0466704_055202 3300042643 Bacteria 5738
39 Ga0466704_057568 3300042643 Bacteria 3271
40 Ga0466704_162945 3300042643 Bacteria 4788
41 Ga0466709_237932 3300042648 Bacteria 7852
42 Ga0466727_170229 3300042655 Bacteria 6312
43 Ga0466714_082006 3300042603 Bacteria 191145
44 Ga0466719_377300 3300042606 Bacteria 1895
45 IMNBL1DRAFT_c0000274 3300000062 Bacteria 45532
46 JGI24702J35022_10032806 3300002462 Bacteria 2779
47 JGI24699J35502_11133334 3300002509 Bacteria 9904
48 Ga0068305_10072625 3300005083 Unclassified 13914
49 Ga0466705_304422 3300042612 Unclassified 1291
50 Ga0466733_125743 3300042659 Bacteria 5829
51 Ga0123354_10000735 3300010882 Bacteria 35280
52 Ga0466726_289930 3300042619 Bacteria 8500
53 Ga0466728_180564 3300042620 Bacteria 92308
54 Ga0466690_096620 3300042590 Bacteria 3835
55 Ga0466691_031003 3300042593 Bacteria 14168
56 Ga0466704_472879 3300042643 Bacteria 13574
57 Ga0466727_076192 3300042655 Bacteria 4594
58 Ga0466707_047433 3300042601 Bacteria 3983
59 Ga0466707_337488 3300042601 Bacteria 18461
60 Ga0466713_021134 3300042602 Bacteria 7003
61 Ga0466716_084851 3300042605 Bacteria 10801
62 Ga0466719_243196 3300042606 Bacteria 2664
63 Ga0466698_492792 3300042610 Unclassified 2289
64 2227610723 2225789004 Bacteria 12124
65 IMNBL1DRAFT_c0001129 3300000062 Bacteria 20460
66 JGI24702J35022_10009097 3300002462 Bacteria 5593
67 Ga0466711_042337 3300042615 Bacteria 11612
68 Ga0466726_425750 3300042619 Bacteria 5812
69 Ga0466692_166187 3300042591 Bacteria 20656
70 Ga0466703_212954 3300042636 Bacteria 10233
71 Ga0466704_176646 3300042643 Bacteria 62821
72 Ga0466704_353772 3300042643 Bacteria 9855
73 Ga0466708_011017 3300042652 Bacteria 14569
74 Ga0466708_023581 3300042652 Bacteria 13912
75 Ga0466700_392445 3300042600 Bacteria 26880
76 2227477119 2225789004 Bacteria 4600
77 JGI24702J35022_10138932 3300002462 Bacteria 1354
78 JGI24702J35022_10232793 3300002462 Unclassified 1066
79 Ga0072941_1121775 3300005201 Bacteria 4303
80 Ga0123353_10053440 3300010167 Bacteria 6456
81 Ga0466728_107024 3300042620 Bacteria 1973
82 Ga0466690_063861 3300042590 Bacteria 11353
83 Ga0466690_258904 3300042590 Bacteria 4664
84 Ga0466692_121070 3300042591 Bacteria 8911
85 Ga0466691_103420 3300042593 Bacteria 10591
86 Ga0466696_105777 3300042596 Bacteria 41166
87 Ga0466703_157640 3300042636 Bacteria 4313
88 Ga0466709_222588 3300042648 Bacteria 4088
89 Ga0466700_428358 3300042600 Bacteria 10709
90 Ga0466707_233995 3300042601 Bacteria 2575
91 Ga0466713_084601 3300042602 Bacteria 2112
92 Ga0466719_364311 3300042606 Bacteria 8124
93 JGI24702J35022_10213639 3300002462 Bacteria 1109
94 Ga0466705_068471 3300042612 Bacteria 9310
95 Ga0466705_091070 3300042612 Bacteria 9169
96 Ga0466705_269867 3300042612 Bacteria 9669
97 Ga0466711_080977 3300042615 Bacteria 6892
98 Ga0466715_621995 3300042616 Bacteria 20259
99 Ga0466728_288205 3300042620 Bacteria 17761
100 Ga0466729_130708 3300042621 Bacteria 3609
101 Ga0265387_1008790 3300024582 Unclassified 1360
102 Ga0466690_253817 3300042590 Bacteria 10765
103 Ga0466696_085036 3300042596 Bacteria 6487
104 Ga0466703_138188 3300042636 Bacteria 2511
105 Ga0466703_170324 3300042636 Bacteria 10917
106 Ga0466704_067267 3300042643 Bacteria 9780
107 Ga0466709_275349 3300042648 Unclassified 4986
108 Ga0466727_090010 3300042655 Bacteria 8453
109 Ga0466727_120961 3300042655 Bacteria 5719
110 Ga0466706_016347 3300042599 Bacteria 3942
111 Ga0466713_020992 3300042602 Bacteria 62959
112 Ga0466714_101114 3300042603 Bacteria 64102
113 2227485761 2225789004 Bacteria 21098
114 JGI24705J35276_12191825 3300002504 Bacteria 1479
115 Ga0466697_140389 3300042611 Bacteria 2101
116 Ga0466733_025416 3300042659 Bacteria 189255
117 Ga0466733_134752 3300042659 Bacteria 3413
118 Ga0466726_096510 3300042619 Bacteria 17649
119 Ga0466657_156355 3300042582 Bacteria 1471
120 Ga0466690_264520 3300042590 Bacteria 31137
121 Ga0466696_123492 3300042596 Bacteria 14968
122 Ga0466696_227170 3300042596 Bacteria 9389
123 Ga0466696_460040 3300042596 Bacteria 2822
124 Ga0466704_016776 3300042643 Bacteria 3845
125 Ga0466727_101685 3300042655 Bacteria 17782
126 Ga0466707_125409 3300042601 Bacteria 15243
127 IMNBL1DRAFT_c0002283 3300000062 Bacteria 13508
128 JGI24698J34947_10026762 3300002449 Bacteria 3062
129 Ga0068305_10020657 3300005083 Bacteria 24279

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005083 Ga0068305_10072625 Ga0068305_100726258 212
2 3300042610 Ga0466698_492792 Ga0466698_492792_1632_2279 215
3 3300005201 Ga0072941_1187421 Ga0072941_11874212 228
4 3300042619 Ga0466726_096510 Ga0466726_096510_13419_14108 229
5 3300042655 Ga0466727_120961 Ga0466727_120961_2637_3326 229
6 3300042612 Ga0466705_304422 Ga0466705_304422_23_730 235
7 3300042621 Ga0466729_304089 Ga0466729_304089_1322_2086 244
8 3300042596 Ga0466696_141833 Ga0466696_141833_15021_15791 246
9 3300042601 Ga0466707_337488 Ga0466707_337488_9153_9908 251
10 2225789004 2227477119 2227930431 252
11 3300000062 IMNBL1DRAFT_c0001129 IMNBL1DRAFT_000112914 252
12 3300042601 Ga0466707_010317 Ga0466707_010317_5366_6124 252
13 3300042601 Ga0466707_047433 Ga0466707_047433_1306_2064 252
14 2225789004 2227485761 2227951871 253
15 3300042590 Ga0466690_063861 Ga0466690_063861_7355_8116 253
16 3300042590 Ga0466690_258904 Ga0466690_258904_107_868 253
17 3300042593 Ga0466691_029267 Ga0466691_029267_395_1156 253
18 3300042593 Ga0466691_031003 Ga0466691_031003_7626_8387 253
19 3300042596 Ga0466696_123492 Ga0466696_123492_1440_2201 253
20 3300042596 Ga0466696_168764 Ga0466696_168764_5440_6201 253
21 3300042600 Ga0466700_428358 Ga0466700_428358_6415_7176 253
22 3300042601 Ga0466707_125409 Ga0466707_125409_9700_10461 253
23 3300042601 Ga0466707_233995 Ga0466707_233995_266_1027 253
24 3300042601 Ga0466707_414711 Ga0466707_414711_4736_5497 253
25 3300042602 Ga0466713_021134 Ga0466713_021134_4814_5575 253
26 3300042605 Ga0466716_084851 Ga0466716_084851_3764_4525 253
27 3300042606 Ga0466719_206576 Ga0466719_206576_2405_3166 253
28 3300042606 Ga0466719_243196 Ga0466719_243196_1801_2562 253
29 3300042606 Ga0466719_364311 Ga0466719_364311_2759_3520 253
30 3300042606 Ga0466719_433192 Ga0466719_433192_1647_2408 253
31 3300042609 Ga0466722_166869 Ga0466722_166869_283_1044 253
32 3300042611 Ga0466697_140389 Ga0466697_140389_194_955 253
33 3300042612 Ga0466705_152618 Ga0466705_152618_9797_10558 253
34 3300042615 Ga0466711_021252 Ga0466711_021252_4371_5132 253
35 3300042616 Ga0466715_323248 Ga0466715_323248_3188_3949 253
36 3300042616 Ga0466715_429111 Ga0466715_429111_3485_4246 253
37 3300042618 Ga0466723_136332 Ga0466723_136332_4452_5213 253
38 3300042619 Ga0466726_289930 Ga0466726_289930_2705_3466 253
39 3300042619 Ga0466726_425750 Ga0466726_425750_2117_2878 253
40 3300042620 Ga0466728_011534 Ga0466728_011534_5465_6226 253
41 3300042620 Ga0466728_107024 Ga0466728_107024_684_1445 253
42 3300042622 Ga0466731_424101 Ga0466731_424101_583_1344 253
43 3300042636 Ga0466703_046877 Ga0466703_046877_707_1468 253
44 3300042636 Ga0466703_048877 Ga0466703_048877_156_917 253
45 3300042636 Ga0466703_212954 Ga0466703_212954_3931_4692 253
46 3300042643 Ga0466704_016776 Ga0466704_016776_2168_2929 253
47 3300042643 Ga0466704_044961 Ga0466704_044961_1538_2299 253
48 3300042643 Ga0466704_055202 Ga0466704_055202_4075_4836 253
49 3300042643 Ga0466704_057568 Ga0466704_057568_1980_2741 253
50 3300042643 Ga0466704_067267 Ga0466704_067267_1612_2373 253
51 3300042643 Ga0466704_353772 Ga0466704_353772_6459_7220 253
52 3300042648 Ga0466709_222588 Ga0466709_222588_2440_3201 253
53 3300042652 Ga0466708_011017 Ga0466708_011017_5071_5832 253
54 3300042655 Ga0466727_076192 Ga0466727_076192_1582_2343 253
55 3300042655 Ga0466727_090010 Ga0466727_090010_2246_3007 253
56 3300042655 Ga0466727_101685 Ga0466727_101685_2205_2966 253
57 3300042655 Ga0466727_170229 Ga0466727_170229_4743_5504 253
58 3300042659 Ga0466733_025416 Ga0466733_025416_168513_169274 253
59 2225789004 2227610723 2228182348 254
60 3300000062 IMNBL1DRAFT_c0000274 IMNBL1DRAFT_000027415 254
61 3300000062 IMNBL1DRAFT_c0002283 IMNBL1DRAFT_00022836 254
62 3300002449 JGI24698J34947_10026762 JGI24698J34947_100267622 254
63 3300002462 JGI24702J35022_10000131 JGI24702J35022_100001317 254
64 3300002462 JGI24702J35022_10009097 JGI24702J35022_100090978 254
65 3300002462 JGI24702J35022_10032806 JGI24702J35022_100328063 254
66 3300002462 JGI24702J35022_10138932 JGI24702J35022_101389322 254
67 3300002462 JGI24702J35022_10232793 JGI24702J35022_102327931 254
68 3300002509 JGI24699J35502_11133334 JGI24699J35502_111333344 254
69 3300005201 Ga0072941_1121775 Ga0072941_11217753 254
70 3300042590 Ga0466690_253817 Ga0466690_253817_8350_9114 254
71 3300042590 Ga0466690_419789 Ga0466690_419789_10891_11655 254
72 3300042591 Ga0466692_001194 Ga0466692_001194_7434_8198 254
73 3300042591 Ga0466692_121070 Ga0466692_121070_3424_4188 254
74 3300042591 Ga0466692_166187 Ga0466692_166187_5443_6207 254
75 3300042593 Ga0466691_103420 Ga0466691_103420_7215_7979 254
76 3300042596 Ga0466696_054052 Ga0466696_054052_2603_3367 254
77 3300042596 Ga0466696_105777 Ga0466696_105777_24972_25736 254
78 3300042599 Ga0466706_016347 Ga0466706_016347_488_1252 254
79 3300042600 Ga0466700_392445 Ga0466700_392445_6591_7355 254
80 3300042602 Ga0466713_020992 Ga0466713_020992_14672_15436 254
81 3300042603 Ga0466714_101114 Ga0466714_101114_5003_5767 254
82 3300042606 Ga0466719_377300 Ga0466719_377300_994_1758 254
83 3300042612 Ga0466705_091070 Ga0466705_091070_4938_5702 254
84 3300042612 Ga0466705_269867 Ga0466705_269867_5567_6331 254
85 3300042615 Ga0466711_042337 Ga0466711_042337_3041_3805 254
86 3300042615 Ga0466711_080977 Ga0466711_080977_4739_5503 254
87 3300042615 Ga0466711_123903 Ga0466711_123903_2274_3038 254
88 3300042615 Ga0466711_288717 Ga0466711_288717_387_1151 254
89 3300042616 Ga0466715_184077 Ga0466715_184077_2724_3488 254
90 3300042616 Ga0466715_255387 Ga0466715_255387_1071_1835 254
91 3300042616 Ga0466715_621995 Ga0466715_621995_8266_9030 254
92 3300042618 Ga0466723_182664 Ga0466723_182664_10458_11222 254
93 3300042620 Ga0466728_288205 Ga0466728_288205_2719_3483 254
94 3300042636 Ga0466703_157640 Ga0466703_157640_2986_3750 254
95 3300042636 Ga0466703_170324 Ga0466703_170324_2323_3087 254
96 3300042643 Ga0466704_176646 Ga0466704_176646_5698_6462 254
97 3300042643 Ga0466704_472879 Ga0466704_472879_7670_8434 254
98 3300042648 Ga0466709_237932 Ga0466709_237932_3739_4503 254
99 iso_pr_bacteria 2940202316 2940204206 254
100 iso_pr_bacteria 2940205530 2940205828 254
101 iso_pr_bacteria 2940212447 2940212745 254
102 iso_pr_bacteria 2940298504 2940298802 254
103 iso_pr_bacteria 2940302308 2940302606 254
104 iso_pr_bacteria 2940306115 2940306736 254
105 iso_pr_bacteria 2940309933 2940310283 254
106 iso_pr_bacteria 2940313741 2940314093 254
107 iso_pr_bacteria 2940317558 2940317908 254
108 iso_pr_bacteria 2940321370 2940321990 254
109 iso_pr_bacteria 2940325180 2940325278 254
110 iso_pr_bacteria 2940328985 2940329084 254
111 iso_pr_bacteria 2940332795 2940333416 254
112 iso_pr_bacteria 3004672520 3004676560 254
113 iso_pr_bacteria 3004677695 3004678511 254
114 3300002462 JGI24702J35022_10213639 JGI24702J35022_102136391 255
115 3300002504 JGI24705J35276_12191825 JGI24705J35276_121918253 255
116 3300005083 Ga0068305_10020657 Ga0068305_1002065713 255
117 3300042605 Ga0466716_068984 Ga0466716_068984_156_923 255
118 3300042618 Ga0466723_095121 Ga0466723_095121_103529_104296 255
119 3300042620 Ga0466728_180564 Ga0466728_180564_59193_59960 255
120 3300042621 Ga0466729_130708 Ga0466729_130708_473_1240 255
121 3300042636 Ga0466703_138188 Ga0466703_138188_27_794 255
122 3300042643 Ga0466704_162945 Ga0466704_162945_2658_3425 255
123 3300042648 Ga0466709_275349 Ga0466709_275349_3922_4689 255
124 3300010167 Ga0123353_10053440 Ga0123353_100534406 256
125 3300042612 Ga0466705_068471 Ga0466705_068471_1719_2489 256
126 3300042652 Ga0466708_023581 Ga0466708_023581_6853_7623 256
127 3300042659 Ga0466733_125743 Ga0466733_125743_446_1216 256
128 iso_pr_bacteria 2820762746 2820764409 256
129 iso_pr_bacteria 2940209341 2940210179 256
130 iso_pr_bacteria 2940346213 2940347667 256
131 3300002509 JGI24699J35502_11134162 JGI24699J35502_1113416226 257
132 iso_pr_bacteria 2923982719 2923984331 257
133 3300010882 Ga0123354_10000735 Ga0123354_1000073523 258
134 3300024582 Ga0265387_1008790 Ga0265387_10087902 259
135 3300042659 Ga0466733_029904 Ga0466733_029904_958_1737 259
136 3300042659 Ga0466733_134752 Ga0466733_134752_1746_2525 259
137 iso_pr_bacteria 2940195863 2940198507 259
138 3300042590 Ga0466690_213523 Ga0466690_213523_4711_5496 261
139 3300042603 Ga0466714_082006 Ga0466714_082006_86916_87701 261
140 3300042623 Ga0466734_060110 Ga0466734_060110_712_1497 261
141 3300042596 Ga0466696_085036 Ga0466696_085036_1565_2353 262
142 3300042596 Ga0466696_227170 Ga0466696_227170_1593_2381 262
143 3300042596 Ga0466696_248480 Ga0466696_248480_1544_2332 262
144 3300042590 Ga0466690_264520 Ga0466690_264520_17912_18703 263
145 3300042602 Ga0466713_084601 Ga0466713_084601_842_1636 264
146 3300042615 Ga0466711_286714 Ga0466711_286714_13452_14249 265
147 3300042590 Ga0466690_096620 Ga0466690_096620_2116_2922 268
148 3300042596 Ga0466696_460040 Ga0466696_460040_1039_1848 269
149 3300042582 Ga0466657_156355 Ga0466657_156355_215_1030 271

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 80 231 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.