Protein Family IF05245

Metagenome Isolate
181 Members
64 Samples
160 Scaffolds
459.08 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_434828|Ga0466696_434828_145_1671
Length
508 aa
Sequence
MGYQPHDKRQYIACYRTAGLNKQETRDKIKIPKMDYSQFLHMRPELSLIAVTMFLFLYDLFAGPKMQPYIQPLSCLLLLIHTMIHIIPSETSCEAFGGMYIRMPVMSIVKSILSAGTLMVVMQSDAWLKRDDTRHKRGEFYMLLLSTLLGMYYMISAGHFLMFVIGVELASIPMACLVAFDKYKHHSAEAGAKYMLSSMFASGLMLFGISFIYGTTGTLYFADTASGLTGSPLQIMAFVFFFSGLGFKISLVPFHLWTADVYEGAPTNVTAYLSVVSKGSAAFTLLIIFIKVFAPMMEIWQEILYPVTVVTITVANLFAIRQKNIKRFFAFSSISQAGYMMLGIIGGNALGMTSLVFYLLAYVVANMAVFGVIAAIEQHTGNSVHIADCNGLYRTNPKLALTMMFALFSLAGIPPFAGFFSKFFIFISAFSSGFRELVFIAIINTVISLYYYLLIVKAMFINENKVPVSYFRSDNYIRSSLLLCLTGILIIGIISSIYDSIHLFGFGV

📊 Sample Types

Isolate 11.6%
Metagenome 88.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.0%
Kalotermitidae 21.9%
Blattidae 17.2%
Unclassified 14.1%
Rhinotermitidae 7.8%
Termopsidae 6.2%
Passalidae 3.1%
Hydrophilidae 3.1%
Tenebrionidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 173
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
2 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
3 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
4 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
5 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
6 3004672520 Bacteroides sp. 51 Isolate Blattidae
7 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
8 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
13 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
14 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
20 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
21 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
22 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
23 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
24 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
28 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
29 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
33 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
34 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
35 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
38 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
39 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
40 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
41 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
42 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
43 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
44 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
45 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
46 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
47 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
48 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
49 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
50 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
51 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
52 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
53 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
54 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
55 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
56 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
57 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
58 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
59 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
60 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
61 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
62 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
63 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
64 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_032844 3300042612 Bacteria 18355
2 Ga0466705_049385 3300042612 Bacteria 4196
3 Ga0466733_055799 3300042659 Bacteria 106016
4 Ga0466711_294594 3300042615 Bacteria 3736
5 Ga0466726_159696 3300042619 Bacteria 14259
6 Ga0466726_486136 3300042619 Bacteria 1799
7 Ga0466729_157922 3300042621 Bacteria 22442
8 Ga0123356_10033272 3300010049 Bacteria 4821
9 Ga0466692_095765 3300042591 Bacteria 12783
10 Ga0466693_148940 3300042592 Bacteria 2732
11 Ga0466693_321533 3300042592 Bacteria 4005
12 Ga0466696_092974 3300042596 Bacteria 6536
13 Ga0466730_072519 3300042625 Bacteria 3145
14 Ga0466704_077859 3300042643 Bacteria 3690
15 Ga0466704_488080 3300042643 Bacteria 6701
16 Ga0466708_223269 3300042652 Bacteria 26840
17 Ga0466727_036996 3300042655 Bacteria 4934
18 Ga0466727_168488 3300042655 Bacteria 5527
19 Ga0466707_359464 3300042601 Bacteria 15596
20 Ga0466716_363582 3300042605 Bacteria 6636
21 Ga0466722_127034 3300042609 Bacteria 4056
22 Ga0466705_335658 3300042612 Bacteria 24109
23 Ga0466733_054986 3300042659 Bacteria 147644
24 Ga0466711_061974 3300042615 Bacteria 4712
25 Ga0466711_390003 3300042615 Bacteria 31775
26 Ga0466726_064602 3300042619 Bacteria 18009
27 Ga0466726_415088 3300042619 Bacteria 2761
28 Ga0466692_014618 3300042591 Bacteria 107882
29 Ga0466692_032473 3300042591 Bacteria 22846
30 Ga0466696_006773 3300042596 Bacteria 2129
31 Ga0466704_148253 3300042643 Bacteria 20299
32 Ga0466704_223852 3300042643 Bacteria 4408
33 Ga0466704_504230 3300042643 Bacteria 4729
34 Ga0466709_246569 3300042648 Bacteria 6238
35 Ga0466724_28535 3300042649 Bacteria 2711
36 Ga0466725_210063 3300042654 Bacteria 11666
37 Ga0466727_219718 3300042655 Bacteria 37959
38 Ga0466701_070186 3300042598 Bacteria 3501
39 Ga0466713_011127 3300042602 Bacteria 1872
40 JGI24702J35022_10023360 3300002462 Bacteria 3344
41 Ga0068302_10340989 3300005071 Bacteria 1616
42 Ga0068305_10096884 3300005083 Unclassified 2079
43 Ga0466705_073835 3300042612 Bacteria 13642
44 Ga0466711_435970 3300042615 Bacteria 27962
45 Ga0466723_092051 3300042618 Bacteria 16294
46 Ga0466729_193935 3300042621 Bacteria 11966
47 Ga0123354_10049615 3300010882 Bacteria 6363
48 Ga0466656_064781 3300042550 Bacteria 21643
49 Ga0466707_323672 3300042601 Bacteria 13232
50 Ga0466707_416919 3300042601 Bacteria 6327
51 Ga0466713_037944 3300042602 Bacteria 60611
52 Ga0466713_149587 3300042602 Bacteria 21967
53 Ga0466722_111573 3300042609 Bacteria 76934
54 Ga0466722_113613 3300042609 Bacteria 129604
55 Ga0466697_034565 3300042611 Unclassified 3748
56 IMNBL1DRAFT_c0010893 3300000062 Bacteria 4302
57 IMNBL1DRAFT_c0030199 3300000062 Unclassified 1991
58 Ga0466715_600406 3300042616 Bacteria 3284
59 Ga0466692_100902 3300042591 Bacteria 68262
60 Ga0466735_026042 3300042624 Bacteria 9130
61 Ga0466735_044630 3300042624 Bacteria 3928
62 Ga0466730_029192 3300042625 Bacteria 6614
63 Ga0466703_040225 3300042636 Bacteria 28005
64 Ga0466704_038381 3300042643 Bacteria 7986
65 Ga0466704_096003 3300042643 Bacteria 3900
66 Ga0466704_424216 3300042643 Bacteria 5738
67 Ga0466704_507270 3300042643 Bacteria 10828
68 Ga0466709_084097 3300042648 Bacteria 147707
69 Ga0466727_107313 3300042655 Bacteria 4927
70 Ga0466707_224426 3300042601 Bacteria 9289
71 Ga0466707_242775 3300042601 Bacteria 11468
72 Ga0466713_140837 3300042602 Bacteria 175760
73 Ga0466716_158063 3300042605 Bacteria 2258
74 Ga0466722_094262 3300042609 Bacteria 9587
75 Ga0068305_10036604 3300005083 Bacteria 13137
76 Ga0068305_10543111 3300005083 Bacteria 2523
77 Ga0466733_077231 3300042659 Bacteria 6792
78 Ga0466733_088005 3300042659 Bacteria 7472
79 Ga0466733_203605 3300042659 Bacteria 93930
80 Ga0466715_129116 3300042616 Unclassified 17950
81 Ga0466723_082168 3300042618 Bacteria 4118
82 Ga0466726_018972 3300042619 Bacteria 4296
83 Ga0466726_201803 3300042619 Bacteria 4762
84 Ga0123354_10000201 3300010882 Bacteria 51540
85 Ga0466692_191366 3300042591 Bacteria 14423
86 Ga0466693_277788 3300042592 Bacteria 2392
87 Ga0466703_067792 3300042636 Bacteria 28120
88 Ga0466704_138475 3300042643 Bacteria 7246
89 Ga0466727_110459 3300042655 Bacteria 3912
90 Ga0466727_218108 3300042655 Bacteria 13790
91 Ga0466701_064159 3300042598 Bacteria 3975
92 Ga0466707_008939 3300042601 Bacteria 6269
93 Ga0466707_062128 3300042601 Bacteria 19135
94 Ga0466713_039084 3300042602 Bacteria 11546
95 Ga0466719_105643 3300042606 Bacteria 2521
96 2227041483 2225789003 Bacteria 4217
97 JGI24699J35502_11134224 3300002509 Bacteria 74083
98 Ga0466705_051371 3300042612 Bacteria 11634
99 Ga0466705_228183 3300042612 Bacteria 5509
100 Ga0466705_357702 3300042612 Bacteria 27661
101 Ga0466733_130577 3300042659 Bacteria 17591
102 Ga0466715_502345 3300042616 Bacteria 3656
103 Ga0466726_152297 3300042619 Unclassified 9072
104 Ga0466726_400766 3300042619 Bacteria 2027
105 Ga0466729_115703 3300042621 Bacteria 5020
106 Ga0466690_075235 3300042590 Bacteria 10422
107 Ga0466690_227384 3300042590 Bacteria 5642
108 Ga0466691_006239 3300042593 Bacteria 10188
109 Ga0466696_026812 3300042596 Bacteria 27611
110 Ga0466731_164719 3300042622 Bacteria 4039
111 Ga0466703_081872 3300042636 Bacteria 1767
112 Ga0466703_125175 3300042636 Bacteria 11887
113 Ga0466703_167319 3300042636 Bacteria 2946
114 Ga0466704_016352 3300042643 Bacteria 60527
115 Ga0466704_602482 3300042643 Bacteria 52119
116 Ga0466708_318365 3300042652 Unclassified 1372
117 Ga0466713_010310 3300042602 Bacteria 41924
118 Ga0466716_296520 3300042605 Bacteria 7271
119 Ga0466719_132573 3300042606 Bacteria 2491
120 IMNBL1DRAFT_c0001469 3300000062 Bacteria 17624
121 Ga0466705_073303 3300042612 Bacteria 8864
122 Ga0466715_245585 3300042616 Bacteria 2451
123 Ga0466715_298519 3300042616 Bacteria 6380
124 Ga0466715_351050 3300042616 Bacteria 23393
125 Ga0466715_576006 3300042616 Bacteria 10093
126 Ga0466726_169010 3300042619 Bacteria 5365
127 Ga0466728_445851 3300042620 Bacteria 7815
128 Ga0466692_035439 3300042591 Bacteria 14978
129 Ga0466692_193845 3300042591 Bacteria 2135
130 Ga0466691_006371 3300042593 Bacteria 3719
131 Ga0466691_056063 3300042593 Bacteria 20184
132 Ga0466694_204609 3300042594 Bacteria 1947
133 Ga0466696_413358 3300042596 Bacteria 3836
134 Ga0466696_434828 3300042596 Bacteria 6894
135 Ga0466701_010273 3300042598 Bacteria 19948
136 Ga0466729_203662 3300042621 Bacteria 3621
137 Ga0466735_111195 3300042624 Bacteria 4138
138 Ga0466703_043912 3300042636 Unclassified 7429
139 Ga0466704_392295 3300042643 Bacteria 2063
140 Ga0466725_243294 3300042654 Bacteria 41653
141 Ga0466727_348535 3300042655 Bacteria 11423
142 Ga0466722_226539 3300042609 Bacteria 5312
143 JGI24699J35502_11134213 3300002509 Bacteria 63023
144 Ga0466733_128483 3300042659 Unclassified 2693
145 Ga0562377_0004 3300056842 Bacteria 3525959
146 Ga0466711_172329 3300042615 Bacteria 9572
147 Ga0466723_032717 3300042618 Bacteria 15968
148 Ga0466723_071061 3300042618 Bacteria 1948
149 Ga0466726_098008 3300042619 Bacteria 12087
150 Ga0466695_384269 3300042595 Bacteria 7224
151 Ga0466696_502391 3300042596 Bacteria 3344
152 Ga0466729_238589 3300042621 Bacteria 3173
153 Ga0466735_024861 3300042624 Bacteria 2966
154 Ga0466703_187328 3300042636 Bacteria 25919
155 Ga0466703_203837 3300042636 Bacteria 13462
156 Ga0466704_036765 3300042643 Bacteria 16967
157 Ga0466708_148220 3300042652 Bacteria 3886
158 Ga0466727_167278 3300042655 Bacteria 64897
159 Ga0466713_130991 3300042602 Bacteria 214088
160 Ga0466714_150199 3300042603 Bacteria 149649

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_435970 Ga0466711_435970_5113_6543 387
2 3300042590 Ga0466690_227384 Ga0466690_227384_3178_4581 404
3 3300042594 Ga0466694_204609 Ga0466694_204609_68_1294 408
4 3300005083 Ga0068305_10096884 Ga0068305_100968842 411
5 3300042596 Ga0466696_413358 Ga0466696_413358_444_1871 411
6 3300042592 Ga0466693_148940 Ga0466693_148940_614_2026 412
7 3300042619 Ga0466726_152297 Ga0466726_152297_216_1640 413
8 3300042636 Ga0466703_040225 Ga0466703_040225_12248_13696 415
9 3300042611 Ga0466697_034565 Ga0466697_034565_115_1545 417
10 3300042609 Ga0466722_127034 Ga0466722_127034_2155_3582 419
11 3300042621 Ga0466729_193935 Ga0466729_193935_5127_6542 419
12 3300042624 Ga0466735_044630 Ga0466735_044630_1285_2715 419
13 3300042655 Ga0466727_167278 Ga0466727_167278_30629_32056 419
14 3300042652 Ga0466708_318365 Ga0466708_318365_95_1360 421
15 3300042598 Ga0466701_064159 Ga0466701_064159_2322_3749 423
16 3300042601 Ga0466707_062128 Ga0466707_062128_10150_11580 424
17 3300042601 Ga0466707_008939 Ga0466707_008939_1572_3008 425
18 3300042649 Ga0466724_28535 Ga0466724_28535_1243_2670 427
19 3300042591 Ga0466692_100902 Ga0466692_100902_12885_14327 429
20 3300042643 Ga0466704_223852 Ga0466704_223852_1508_2983 429
21 3300042615 Ga0466711_390003 Ga0466711_390003_10364_11788 430
22 3300042655 Ga0466727_348535 Ga0466727_348535_7672_9075 430
23 3300005083 Ga0068305_10543111 Ga0068305_105431112 431
24 3300010882 Ga0123354_10049615 Ga0123354_100496153 431
25 3300010049 Ga0123356_10033272 Ga0123356_100332723 434
26 3300042619 Ga0466726_400766 Ga0466726_400766_458_1861 435
27 3300000062 IMNBL1DRAFT_c0010893 IMNBL1DRAFT_00108933 437
28 3300002509 JGI24699J35502_11134213 JGI24699J35502_1113421337 439
29 3300042593 Ga0466691_006371 Ga0466691_006371_745_2160 439
30 3300042615 Ga0466711_294594 Ga0466711_294594_1713_3119 439
31 3300042621 Ga0466729_203662 Ga0466729_203662_984_2405 439
32 3300042643 Ga0466704_424216 Ga0466704_424216_3792_5213 439
33 3300042605 Ga0466716_158063 Ga0466716_158063_16_1437 440
34 3300042609 Ga0466722_226539 Ga0466722_226539_312_1733 440
35 3300042618 Ga0466723_071061 Ga0466723_071061_434_1855 440
36 3300042618 Ga0466723_082168 Ga0466723_082168_2604_4025 440
37 3300042619 Ga0466726_159696 Ga0466726_159696_12650_14074 440
38 3300002509 JGI24699J35502_11134224 JGI24699J35502_1113422432 442
39 3300042593 Ga0466691_056063 Ga0466691_056063_4309_5730 442
40 3300042655 Ga0466727_036996 Ga0466727_036996_1635_3059 442
41 3300042590 Ga0466690_075235 Ga0466690_075235_6951_8363 443
42 3300042612 Ga0466705_073303 Ga0466705_073303_1801_3216 443
43 3300042643 Ga0466704_138475 Ga0466704_138475_3157_4572 443
44 3300010882 Ga0123354_10000201 Ga0123354_1000020134 444
45 3300042591 Ga0466692_191366 Ga0466692_191366_1317_2750 445
46 3300042598 Ga0466701_070186 Ga0466701_070186_656_2062 445
47 3300042624 Ga0466735_024861 Ga0466735_024861_55_1461 445
48 3300042659 Ga0466733_088005 Ga0466733_088005_856_2292 445
49 3300042601 Ga0466707_242775 Ga0466707_242775_8693_10126 447
50 3300042609 Ga0466722_113613 Ga0466722_113613_92087_93523 448
51 3300042619 Ga0466726_486136 Ga0466726_486136_224_1669 448
52 3300042621 Ga0466729_115703 Ga0466729_115703_1462_2892 449
53 3300042591 Ga0466692_193845 Ga0466692_193845_430_1857 452
54 3300042596 Ga0466696_006773 Ga0466696_006773_294_1715 452
55 3300042636 Ga0466703_081872 Ga0466703_081872_293_1726 453
56 3300042643 Ga0466704_148253 Ga0466704_148253_11392_12795 453
57 3300042643 Ga0466704_036765 Ga0466704_036765_11496_12938 454
58 3300042648 Ga0466709_246569 Ga0466709_246569_225_1631 454
59 3300042598 Ga0466701_010273 Ga0466701_010273_16471_17898 455
60 3300042624 Ga0466735_111195 Ga0466735_111195_802_2235 456
61 3300042636 Ga0466703_125175 Ga0466703_125175_10408_11802 456
62 3300042591 Ga0466692_014618 Ga0466692_014618_43444_44877 457
63 3300042591 Ga0466692_032473 Ga0466692_032473_5656_7092 457
64 3300042655 Ga0466727_218108 Ga0466727_218108_5635_7008 457
65 3300042659 Ga0466733_128483 Ga0466733_128483_266_1690 458
66 3300042591 Ga0466692_035439 Ga0466692_035439_6740_8167 459
67 3300042605 Ga0466716_363582 Ga0466716_363582_1857_3293 459
68 3300042619 Ga0466726_415088 Ga0466726_415088_851_2281 459
69 3300042643 Ga0466704_096003 Ga0466704_096003_548_1978 459
70 3300042655 Ga0466727_107313 Ga0466727_107313_308_1738 459
71 3300042601 Ga0466707_224426 Ga0466707_224426_7277_8707 460
72 3300042612 Ga0466705_051371 Ga0466705_051371_3778_5205 461
73 3300042643 Ga0466704_507270 Ga0466704_507270_2179_3627 461
74 3300042616 Ga0466715_502345 Ga0466715_502345_903_2309 462
75 3300042624 Ga0466735_026042 Ga0466735_026042_554_1990 462
76 3300042619 Ga0466726_169010 Ga0466726_169010_1941_3362 463
77 3300042550 Ga0466656_064781 Ga0466656_064781_14092_15486 464
78 3300042609 Ga0466722_094262 Ga0466722_094262_4031_5449 464
79 3300042643 Ga0466704_038381 Ga0466704_038381_6525_7970 464
80 3300042655 Ga0466727_168488 Ga0466727_168488_3656_5050 464
81 3300042596 Ga0466696_026812 Ga0466696_026812_8856_10253 465
82 3300042601 Ga0466707_359464 Ga0466707_359464_9168_10568 466
83 3300042602 Ga0466713_039084 Ga0466713_039084_2338_3762 466
84 3300042602 Ga0466713_130991 Ga0466713_130991_196348_197748 466
85 3300042615 Ga0466711_172329 Ga0466711_172329_1334_2734 466
86 3300042659 Ga0466733_054986 Ga0466733_054986_88148_89572 466
87 3300042659 Ga0466733_077231 Ga0466733_077231_2937_4337 466
88 3300042596 Ga0466696_092974 Ga0466696_092974_3138_4559 467
89 3300042612 Ga0466705_049385 Ga0466705_049385_1172_2626 467
90 3300042619 Ga0466726_018972 Ga0466726_018972_383_1804 467
91 3300042636 Ga0466703_167319 Ga0466703_167319_1158_2612 467
92 3300042636 Ga0466703_187328 Ga0466703_187328_7395_8819 467
93 3300042652 Ga0466708_223269 Ga0466708_223269_7480_8883 467
94 iso_pr_bacteria 2820757377 2820759827 467
95 3300042605 Ga0466716_296520 Ga0466716_296520_841_2247 468
96 3300042606 Ga0466719_132573 Ga0466719_132573_573_1979 468
97 3300042621 Ga0466729_238589 Ga0466729_238589_71_1495 469
98 3300042625 Ga0466730_029192 Ga0466730_029192_3285_4712 469
99 3300042596 Ga0466696_502391 Ga0466696_502391_1754_3220 470
100 3300042652 Ga0466708_148220 Ga0466708_148220_160_1572 470
101 3300042606 Ga0466719_105643 Ga0466719_105643_469_1884 471
102 3300042615 Ga0466711_061974 Ga0466711_061974_1230_2645 471
103 3300042618 Ga0466723_032717 Ga0466723_032717_5852_7267 471
104 3300042655 Ga0466727_110459 Ga0466727_110459_257_1672 471
105 3300042593 Ga0466691_006239 Ga0466691_006239_1178_2596 472
106 3300042612 Ga0466705_357702 Ga0466705_357702_11498_12916 472
107 3300042622 Ga0466731_164719 Ga0466731_164719_1733_3151 472
108 3300042592 Ga0466693_277788 Ga0466693_277788_418_1839 473
109 3300042592 Ga0466693_321533 Ga0466693_321533_2439_3860 473
110 3300042619 Ga0466726_098008 Ga0466726_098008_10529_11950 473
111 3300042636 Ga0466703_043912 Ga0466703_043912_5150_6571 473
112 3300042636 Ga0466703_203837 Ga0466703_203837_11751_13172 473
113 3300042643 Ga0466704_016352 Ga0466704_016352_52872_54293 473
114 3300042655 Ga0466727_219718 Ga0466727_219718_15795_17216 473
115 2225789003 2227041483 2227401312 474
116 3300002462 JGI24702J35022_10023360 JGI24702J35022_100233603 474
117 3300042601 Ga0466707_323672 Ga0466707_323672_11073_12497 474
118 3300042602 Ga0466713_037944 Ga0466713_037944_26404_27828 474
119 3300042616 Ga0466715_129116 Ga0466715_129116_15505_16929 474
120 3300042616 Ga0466715_245585 Ga0466715_245585_1005_2429 474
121 3300042616 Ga0466715_576006 Ga0466715_576006_4517_5941 474
122 3300042616 Ga0466715_600406 Ga0466715_600406_385_1809 474
123 3300042618 Ga0466723_092051 Ga0466723_092051_328_1752 474
124 3300042621 Ga0466729_157922 Ga0466729_157922_5195_6619 474
125 3300042625 Ga0466730_072519 Ga0466730_072519_878_2302 474
126 3300042643 Ga0466704_392295 Ga0466704_392295_547_1971 474
127 3300042643 Ga0466704_488080 Ga0466704_488080_3526_4950 474
128 3300042648 Ga0466709_084097 Ga0466709_084097_130669_132093 474
129 3300042654 Ga0466725_210063 Ga0466725_210063_1582_3006 474
130 3300042659 Ga0466733_203605 Ga0466733_203605_58651_60075 474
131 iso_pr_bacteria 2695420314 2695472621 474
132 iso_pr_bacteria 2820759988 2820762536 474
133 iso_pr_bacteria 2910942425 2910945733 474
134 iso_pr_bacteria 2910959314 2910959452 474
135 iso_pr_bacteria 2940244548 2940248358 474
136 iso_pr_bacteria 2940248789 2940252555 474
137 iso_pr_bacteria 2940253009 2940256755 474
138 iso_pr_bacteria 2940257232 2940260901 474
139 iso_pr_bacteria 8100166142 8100169492 474
140 3300000062 IMNBL1DRAFT_c0001469 IMNBL1DRAFT_000146911 475
141 3300000062 IMNBL1DRAFT_c0030199 IMNBL1DRAFT_00301991 475
142 3300042595 Ga0466695_384269 Ga0466695_384269_4688_6115 475
143 3300042601 Ga0466707_416919 Ga0466707_416919_2347_3774 475
144 3300042602 Ga0466713_140837 Ga0466713_140837_69587_71014 475
145 3300042602 Ga0466713_149587 Ga0466713_149587_20442_21869 475
146 3300042612 Ga0466705_073835 Ga0466705_073835_11257_12684 475
147 3300042612 Ga0466705_228183 Ga0466705_228183_3162_4589 475
148 3300042612 Ga0466705_335658 Ga0466705_335658_12911_14338 475
149 3300042616 Ga0466715_298519 Ga0466715_298519_34_1461 475
150 3300042616 Ga0466715_351050 Ga0466715_351050_10526_11953 475
151 3300042619 Ga0466726_201803 Ga0466726_201803_2986_4413 475
152 3300042620 Ga0466728_445851 Ga0466728_445851_3086_4513 475
153 3300042636 Ga0466703_067792 Ga0466703_067792_1510_2937 475
154 3300042654 Ga0466725_243294 Ga0466725_243294_40005_41432 475
155 3300042659 Ga0466733_055799 Ga0466733_055799_72299_73726 475
156 iso_pr_bacteria 2910949487 2910951837 475
157 iso_pr_bacteria 2940193328 2940195426 475
158 iso_pr_bacteria 2940336608 2940338700 475
159 3300005071 Ga0068302_10340989 Ga0068302_103409891 476
160 3300042591 Ga0466692_095765 Ga0466692_095765_9209_10639 476
161 3300042602 Ga0466713_011127 Ga0466713_011127_201_1631 476
162 3300042612 Ga0466705_032844 Ga0466705_032844_12445_13875 476
163 3300042619 Ga0466726_064602 Ga0466726_064602_16007_17437 476
164 3300042643 Ga0466704_077859 Ga0466704_077859_1916_3346 476
165 3300042643 Ga0466704_602482 Ga0466704_602482_10262_11692 476
166 3300056842 Ga0562377_0004 Ga0562377_0004_3343511_3344941 476
167 3300042609 Ga0466722_111573 Ga0466722_111573_44812_46245 477
168 3300042659 Ga0466733_130577 Ga0466733_130577_4611_6044 477
169 iso_pr_bacteria 2695420317 2695483562 477
170 iso_pr_bacteria 2695420931 2698111059 477
171 iso_pr_bacteria 2873600114 2873601769 477
172 iso_pr_bacteria 2873610414 2873612150 477
173 iso_pr_bacteria 2910930387 2910930856 477
174 iso_pr_bacteria 8100157865 8100159129 477
175 3300042603 Ga0466714_150199 Ga0466714_150199_44862_46298 478
176 3300042643 Ga0466704_504230 Ga0466704_504230_350_1786 478
177 iso_pr_bacteria 2967483437 2967485646 478
178 3300042602 Ga0466713_010310 Ga0466713_010310_16359_17798 479
179 iso_pr_bacteria 3004672520 3004675560 479
180 3300005083 Ga0068305_10036604 Ga0068305_100366042 480
181 3300042596 Ga0466696_434828 Ga0466696_434828_145_1671 508

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00361 Proton_antipo_M Proton-conducting membrane transporter 157 448 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.