Protein Family IF05238

Metagenome Isolate
175 Members
49 Samples
165 Scaffolds
417.27 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_397462|Ga0466696_397462_979_2403
Length
474 aa
Sequence
MLGARCGSISALWMAGSFTYGDGLRGETRRPGFSVRNDASSRSNTKDLGREKMEYFVEQALNYTECLNKIRTKYGERVTILYHKNIRMGGIFGLFAKDGVEITGFTANNYAKNLNVATHASSMLAPSEPKKPLDFNEEKKRFVEMGGAAKKEEPTLMKVLEEMKSINEKLNVNAASPLRAEQAPHSTLVRLSEALALNDFSQSYIQNIIERCKKEISLESLNDYDAVQDKALEWIGETILIYKEAKVYKKPRVMVLVGPTGVGKTTTIAKLAAIYGIGSSAKPPVSVLMITIDAFRIGAKAQIEAYGNIMELPVSYVEDYDDLKRTIAQHSDDVDLILVDTIGKSPRDSVKLGEMKQLLDACGPHAEVHLAVAATTKSSDIKEILRQFEPFNYRSVIITKLDETTRMGNVISAISEKGKLVSYITDGQKVPSDIQTASVVRFLINLEGFHVKRSKIEERFPYGADERIQWKNRL

📊 Sample Types

Isolate 5.7%
Metagenome 94.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.7%
Kalotermitidae 28.6%
Unclassified 22.4%
Rhinotermitidae 8.2%
Termopsidae 6.1%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 172
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
10 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
22 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
23 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
26 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
41 2820016619 Unclassified Spirochaetes Nt197P3bin71 Isolate Unclassified
42 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
43 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
48 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
49 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_394593 3300042612 Bacteria 10227
2 Ga0466705_411719 3300042612 Bacteria 8684
3 Ga0466712_102687 3300042614 Bacteria 1766
4 Ga0466712_274858 3300042614 Bacteria 49650
5 Ga0466718_131430 3300042617 Unclassified 7401
6 Ga0466723_112988 3300042618 Bacteria 28451
7 Ga0123357_10073800 3300009784 Bacteria 4516
8 Ga0123353_10258551 3300010167 Bacteria 2691
9 Ga0466703_250068 3300042636 Bacteria 27509
10 Ga0466708_449846 3300042652 Bacteria 2061
11 Ga0456237_0000241 3300041968 Bacteria 7982
12 Ga0466690_144218 3300042590 Bacteria 24655
13 Ga0466690_202209 3300042590 Bacteria 3283
14 Ga0466691_182649 3300042593 Bacteria 13267
15 Ga0466696_183944 3300042596 Bacteria 11651
16 JGI24702J35022_10003206 3300002462 Bacteria 9889
17 JGI24702J35022_10027628 3300002462 Bacteria 3052
18 Ga0466716_023523 3300042605 Bacteria 9758
19 Ga0466719_004821 3300042606 Bacteria 22594
20 Ga0466719_243719 3300042606 Bacteria 31002
21 Ga0466720_097759 3300042607 Bacteria 20759
22 Ga0466722_007302 3300042609 Bacteria 18801
23 Ga0466722_009932 3300042609 Bacteria 19464
24 Ga0466722_031083 3300042609 Bacteria 44330
25 Ga0466705_209789 3300042612 Bacteria 47591
26 Ga0466715_134736 3300042616 Bacteria 16696
27 Ga0466715_301038 3300042616 Bacteria 16262
28 Ga0466723_200749 3300042618 Bacteria 72306
29 Ga0466726_167928 3300042619 Bacteria 3162
30 Ga0466726_310436 3300042619 Bacteria 6615
31 Ga0123356_10027718 3300010049 Bacteria 5308
32 Ga0123353_10016476 3300010167 Bacteria 10806
33 Ga0123353_10046275 3300010167 Bacteria 6911
34 Ga0123353_10120092 3300010167 Bacteria 4226
35 Ga0466703_087402 3300042636 Bacteria 31745
36 Ga0466703_187864 3300042636 Bacteria 71803
37 Ga0466704_170845 3300042643 Bacteria 10005
38 Ga0466708_111503 3300042652 Bacteria 12449
39 Ga0466708_229267 3300042652 Bacteria 22598
40 Ga0466708_338747 3300042652 Bacteria 15647
41 Ga0466727_026473 3300042655 Bacteria 5160
42 Ga0466727_116649 3300042655 Bacteria 15287
43 Ga0456237_0003136 3300041968 Bacteria 2687
44 JGI24695J34938_10006217 3300002450 Unclassified 7249
45 JGI24702J35022_10019335 3300002462 Bacteria 3705
46 Ga0466707_071581 3300042601 Bacteria 1574
47 Ga0466720_071539 3300042607 Bacteria 31117
48 Ga0466721_025519 3300042608 Bacteria 3711
49 Ga0466705_202934 3300042612 Bacteria 22495
50 Ga0466711_216896 3300042615 Bacteria 77790
51 Ga0466726_098494 3300042619 Bacteria 33073
52 Ga0466726_147541 3300042619 Bacteria 36898
53 Ga0466726_277165 3300042619 Bacteria 2649
54 Ga0466726_382659 3300042619 Bacteria 18394
55 Ga0123353_10211973 3300010167 Bacteria 3037
56 Ga0466729_280285 3300042621 Bacteria 6748
57 Ga0466735_220266 3300042624 Bacteria 2114
58 Ga0466704_063886 3300042643 Bacteria 26674
59 Ga0466704_297862 3300042643 Bacteria 9900
60 Ga0466708_007489 3300042652 Bacteria 20731
61 Ga0466708_059408 3300042652 Bacteria 2007
62 Ga0466708_144606 3300042652 Bacteria 5948
63 Ga0466696_149692 3300042596 Bacteria 17333
64 Ga0466696_331190 3300042596 Bacteria 65152
65 Ga0466696_376400 3300042596 Bacteria 6647
66 JGI24698J34947_10017310 3300002449 Bacteria 3907
67 Ga0123357_10000117 3300009784 Bacteria 67273
68 Ga0466719_023777 3300042606 Bacteria 34238
69 Ga0466712_259449 3300042614 Bacteria 13229
70 Ga0466711_054871 3300042615 Bacteria 21842
71 Ga0466715_013788 3300042616 Bacteria 6967
72 Ga0466715_140625 3300042616 Bacteria 6882
73 Ga0466715_224726 3300042616 Bacteria 3567
74 Ga0466715_242240 3300042616 Bacteria 8392
75 Ga0466726_034817 3300042619 Bacteria 5491
76 Ga0466728_403318 3300042620 Bacteria 13612
77 Ga0466703_143773 3300042636 Bacteria 24097
78 Ga0466704_134136 3300042643 Bacteria 31349
79 Ga0466704_288508 3300042643 Bacteria 14887
80 Ga0466727_132560 3300042655 Bacteria 3399
81 Ga0415639_034817 3300038395 Bacteria 6037
82 Ga0466691_072046 3300042593 Bacteria 19393
83 AustNasuHG_c1001027 3300000089 Bacteria 10052
84 Ga0466716_270520 3300042605 Bacteria 2057
85 Ga0466722_035441 3300042609 Bacteria 26035
86 Ga0466722_251234 3300042609 Bacteria 3567
87 Ga0466705_525731 3300042612 Bacteria 8810
88 Ga0466728_373591 3300042620 Bacteria 10747
89 Ga0466735_219670 3300042624 Bacteria 1526
90 Ga0466703_362031 3300042636 Bacteria 1673
91 Ga0466704_556679 3300042643 Bacteria 57080
92 Ga0456237_0001356 3300041968 Bacteria 3889
93 Ga0466690_433168 3300042590 Bacteria 3123
94 Ga0466692_102409 3300042591 Bacteria 11330
95 Ga0466694_031525 3300042594 Bacteria 37805
96 Ga0466699_167803 3300042597 Bacteria 2011
97 Ga0466707_364693 3300042601 Bacteria 12364
98 Ga0466716_073141 3300042605 Bacteria 3953
99 Ga0466722_028325 3300042609 Bacteria 9494
100 Ga0466722_064604 3300042609 Bacteria 35013
101 Ga0466722_119857 3300042609 Bacteria 2744
102 Ga0466705_230922 3300042612 Bacteria 28521
103 Ga0466723_072479 3300042618 Bacteria 28033
104 Ga0466723_080092 3300042618 Bacteria 7611
105 Ga0466723_135937 3300042618 Bacteria 21870
106 Ga0466726_061649 3300042619 Bacteria 17192
107 Ga0466726_139023 3300042619 Bacteria 48573
108 Ga0466726_375410 3300042619 Bacteria 11809
109 Ga0466728_007179 3300042620 Bacteria 31291
110 Ga0123357_10005590 3300009784 Bacteria 15106
111 Ga0123353_10195972 3300010167 Bacteria 3184
112 Ga0123353_10423597 3300010167 Bacteria 1971
113 Ga0466704_120913 3300042643 Bacteria 48720
114 Ga0466727_134172 3300042655 Bacteria 2407
115 Ga0415639_051838 3300038395 Bacteria 5533
116 Ga0466690_364547 3300042590 Bacteria 36984
117 Ga0466692_111799 3300042591 Bacteria 1960
118 Ga0466692_201021 3300042591 Bacteria 9567
119 Ga0466691_116291 3300042593 Bacteria 7721
120 Ga0466691_118331 3300042593 Bacteria 63226
121 Ga0466691_129862 3300042593 Bacteria 25527
122 Ga0466699_243834 3300042597 Bacteria 9207
123 Ga0466699_291421 3300042597 Bacteria 2675
124 Ga0466707_268790 3300042601 Bacteria 2861
125 Ga0466716_505875 3300042605 Bacteria 2037
126 Ga0466719_544255 3300042606 Bacteria 14999
127 Ga0466722_115236 3300042609 Bacteria 8566
128 Ga0466722_253920 3300042609 Unclassified 1514
129 Ga0466732_222241 3300042656 Bacteria 2892
130 Ga0466712_181647 3300042614 Bacteria 18811
131 Ga0466711_026706 3300042615 Bacteria 17084
132 Ga0466715_462513 3300042616 Bacteria 17159
133 Ga0466723_199918 3300042618 Bacteria 15235
134 Ga0466726_335483 3300042619 Bacteria 23284
135 Ga0466728_040479 3300042620 Bacteria 30440
136 Ga0123357_10275439 3300009784 Bacteria 1749
137 Ga0123355_10023236 3300009826 Bacteria 9955
138 Ga0466709_402198 3300042648 Bacteria 9829
139 Ga0466691_006370 3300042593 Bacteria 22207
140 Ga0466694_124255 3300042594 Bacteria 2415
141 Ga0466696_397462 3300042596 Bacteria 14126
142 Ga0466699_134255 3300042597 Bacteria 2805
143 JGI24698J34947_10002844 3300002449 Bacteria 9384
144 JGI24698J34947_10004036 3300002449 Bacteria 7976
145 JGI24695J34938_10017874 3300002450 Bacteria 3561
146 Ga0466706_157465 3300042599 Bacteria 8538
147 Ga0466716_083757 3300042605 Bacteria 17526
148 Ga0466719_291744 3300042606 Bacteria 11276
149 Ga0466722_026120 3300042609 Bacteria 11257
150 Ga0466705_007122 3300042612 Bacteria 14710
151 Ga0466705_104454 3300042612 Bacteria 2211
152 Ga0466711_379169 3300042615 Bacteria 28919
153 Ga0466715_077891 3300042616 Bacteria 3494
154 Ga0466715_142809 3300042616 Bacteria 11642
155 Ga0466715_564072 3300042616 Bacteria 16108
156 Ga0466726_492093 3300042619 Bacteria 1349
157 Ga0123353_10369067 3300010167 Bacteria 2153
158 Ga0466703_093126 3300042636 Bacteria 24260
159 Ga0466704_379885 3300042643 Bacteria 13731
160 Ga0415639_001130 3300038395 Bacteria 14482
161 Ga0466692_199825 3300042591 Bacteria 4718
162 AustNasuHG_c1002449 3300000089 Bacteria 6711
163 JGI24698J34947_10017971 3300002449 Bacteria 3827
164 Ga0466719_495967 3300042606 Bacteria 34420
165 Ga0466705_069437 3300042612 Bacteria 13327

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_268790 Ga0466707_268790_1744_2811 355
2 3300042624 Ga0466735_220266 Ga0466735_220266_919_2094 363
3 3300042656 Ga0466732_222241 Ga0466732_222241_1721_2866 369
4 3300042619 Ga0466726_335483 Ga0466726_335483_7260_8531 382
5 3300042643 Ga0466704_288508 Ga0466704_288508_1537_2832 382
6 3300042619 Ga0466726_167928 Ga0466726_167928_1175_2419 383
7 3300042591 Ga0466692_199825 Ga0466692_199825_3293_4582 385
8 3300042624 Ga0466735_219670 Ga0466735_219670_346_1506 386
9 3300038395 Ga0415639_001130 Ga0415639_001130_7724_9001 387
10 3300042605 Ga0466716_083757 Ga0466716_083757_13939_15240 388
11 3300042619 Ga0466726_492093 Ga0466726_492093_86_1261 391
12 3300042636 Ga0466703_143773 Ga0466703_143773_16299_17594 391
13 3300042590 Ga0466690_202209 Ga0466690_202209_378_1706 393
14 3300042609 Ga0466722_064604 Ga0466722_064604_16418_17677 393
15 3300002450 JGI24695J34938_10006217 JGI24695J34938_100062173 394
16 3300042615 Ga0466711_216896 Ga0466711_216896_41309_42523 394
17 3300042612 Ga0466705_230922 Ga0466705_230922_208_1482 396
18 3300042652 Ga0466708_111503 Ga0466708_111503_6168_7490 396
19 3300042597 Ga0466699_243834 Ga0466699_243834_2917_4224 397
20 3300010167 Ga0123353_10211973 Ga0123353_102119733 398
21 3300042597 Ga0466699_167803 Ga0466699_167803_40_1299 399
22 3300042609 Ga0466722_009932 Ga0466722_009932_14572_15804 399
23 3300042591 Ga0466692_102409 Ga0466692_102409_8873_10075 400
24 3300042609 Ga0466722_119857 Ga0466722_119857_941_2173 400
25 3300042620 Ga0466728_007179 Ga0466728_007179_21135_22337 400
26 iso_pr_bacteria 2820016619 2820017434 400
27 3300042615 Ga0466711_379169 Ga0466711_379169_3364_4569 401
28 3300002450 JGI24695J34938_10017874 JGI24695J34938_100178742 402
29 3300042590 Ga0466690_433168 Ga0466690_433168_1652_2860 402
30 3300042605 Ga0466716_073141 Ga0466716_073141_2051_3259 402
31 3300042618 Ga0466723_072479 Ga0466723_072479_14210_15418 402
32 3300042606 Ga0466719_243719 Ga0466719_243719_23129_24340 403
33 3300042609 Ga0466722_115236 Ga0466722_115236_5464_6720 403
34 3300042612 Ga0466705_069437 Ga0466705_069437_1408_2706 403
35 3300042652 Ga0466708_229267 Ga0466708_229267_5012_6223 403
36 3300042609 Ga0466722_251234 Ga0466722_251234_681_1943 404
37 3300042652 Ga0466708_059408 Ga0466708_059408_393_1607 404
38 3300042652 Ga0466708_449846 Ga0466708_449846_447_1661 404
39 3300010049 Ga0123356_10027718 Ga0123356_100277183 405
40 3300042609 Ga0466722_026120 Ga0466722_026120_3965_5218 405
41 3300042593 Ga0466691_118331 Ga0466691_118331_39274_40548 406
42 3300042601 Ga0466707_364693 Ga0466707_364693_1502_2722 406
43 3300042606 Ga0466719_004821 Ga0466719_004821_16000_17328 406
44 3300042619 Ga0466726_139023 Ga0466726_139023_20933_22198 406
45 3300042652 Ga0466708_144606 Ga0466708_144606_2201_3502 406
46 3300042599 Ga0466706_157465 Ga0466706_157465_3086_4309 407
47 3300009784 Ga0123357_10000117 Ga0123357_1000011710 408
48 3300042593 Ga0466691_116291 Ga0466691_116291_1137_2447 408
49 3300042605 Ga0466716_505875 Ga0466716_505875_566_1792 408
50 3300042606 Ga0466719_291744 Ga0466719_291744_7034_8260 408
51 3300042612 Ga0466705_202934 Ga0466705_202934_5059_6285 408
52 3300042616 Ga0466715_134736 Ga0466715_134736_7761_8987 408
53 3300042620 Ga0466728_403318 Ga0466728_403318_4484_5800 408
54 3300042609 Ga0466722_253920 Ga0466722_253920_232_1461 409
55 3300042619 Ga0466726_375410 Ga0466726_375410_3810_5039 409
56 3300042655 Ga0466727_132560 Ga0466727_132560_1281_2579 410
57 3300009784 Ga0123357_10073800 Ga0123357_100738002 411
58 3300042652 Ga0466708_338747 Ga0466708_338747_1923_3215 411
59 3300009784 Ga0123357_10005590 Ga0123357_100055908 412
60 3300042597 Ga0466699_134255 Ga0466699_134255_734_2038 412
61 3300042612 Ga0466705_411719 Ga0466705_411719_315_1601 412
62 3300042615 Ga0466711_054871 Ga0466711_054871_13461_14771 412
63 3300038395 Ga0415639_034817 Ga0415639_034817_3666_4907 413
64 3300042590 Ga0466690_364547 Ga0466690_364547_13219_14496 413
65 3300042614 Ga0466712_259449 Ga0466712_259449_4083_5387 413
66 3300042615 Ga0466711_026706 Ga0466711_026706_15572_16813 413
67 3300042618 Ga0466723_135937 Ga0466723_135937_16167_17471 413
68 3300002449 JGI24698J34947_10004036 JGI24698J34947_100040362 414
69 3300042601 Ga0466707_071581 Ga0466707_071581_118_1362 414
70 3300042619 Ga0466726_310436 Ga0466726_310436_4656_5900 414
71 3300042593 Ga0466691_072046 Ga0466691_072046_10565_11854 415
72 3300042606 Ga0466719_495967 Ga0466719_495967_11878_13212 415
73 3300042619 Ga0466726_147541 Ga0466726_147541_20811_22058 415
74 3300042619 Ga0466726_277165 Ga0466726_277165_332_1609 415
75 3300041968 Ga0456237_0003136 Ga0456237_0003136_624_1901 416
76 3300042619 Ga0466726_034817 Ga0466726_034817_2761_4053 416
77 3300042619 Ga0466726_098494 Ga0466726_098494_13468_14742 416
78 3300042620 Ga0466728_040479 Ga0466728_040479_17292_18542 416
79 3300042655 Ga0466727_026473 Ga0466727_026473_3506_4756 416
80 3300042616 Ga0466715_224726 Ga0466715_224726_570_1907 417
81 3300042616 Ga0466715_564072 Ga0466715_564072_5579_6850 417
82 3300042619 Ga0466726_061649 Ga0466726_061649_7296_8549 417
83 3300002449 JGI24698J34947_10002844 JGI24698J34947_100028447 418
84 3300009784 Ga0123357_10275439 Ga0123357_102754392 418
85 3300042643 Ga0466704_134136 Ga0466704_134136_13513_14850 418
86 3300042655 Ga0466727_116649 Ga0466727_116649_640_1920 418
87 3300010167 Ga0123353_10258551 Ga0123353_102585513 419
88 3300042617 Ga0466718_131430 Ga0466718_131430_4330_5589 419
89 3300042614 Ga0466712_181647 Ga0466712_181647_16444_17796 420
90 3300002462 JGI24702J35022_10003206 JGI24702J35022_100032069 421
91 3300041968 Ga0456237_0000241 Ga0456237_0000241_1731_2996 421
92 3300042605 Ga0466716_270520 Ga0466716_270520_159_1502 421
93 3300042621 Ga0466729_280285 Ga0466729_280285_3814_5079 421
94 3300042636 Ga0466703_362031 Ga0466703_362031_40_1344 421
95 3300042609 Ga0466722_028325 Ga0466722_028325_3890_5158 422
96 3300042612 Ga0466705_104454 Ga0466705_104454_682_1971 422
97 3300042618 Ga0466723_200749 Ga0466723_200749_9998_11266 422
98 3300042620 Ga0466728_373591 Ga0466728_373591_993_2291 422
99 3300042609 Ga0466722_007302 Ga0466722_007302_6802_8073 423
100 3300042612 Ga0466705_394593 Ga0466705_394593_6441_7712 423
101 3300042616 Ga0466715_077891 Ga0466715_077891_1654_2970 423
102 3300010167 Ga0123353_10016476 Ga0123353_100164764 424
103 3300038395 Ga0415639_051838 Ga0415639_051838_2982_4256 424
104 3300042596 Ga0466696_183944 Ga0466696_183944_6380_7654 424
105 3300042616 Ga0466715_242240 Ga0466715_242240_5992_7362 424
106 3300042636 Ga0466703_250068 Ga0466703_250068_17781_19055 424
107 3300042643 Ga0466704_379885 Ga0466704_379885_5937_7211 424
108 3300010167 Ga0123353_10120092 Ga0123353_101200923 425
109 3300042596 Ga0466696_149692 Ga0466696_149692_10435_11754 425
110 3300042597 Ga0466699_291421 Ga0466699_291421_903_2180 425
111 3300042612 Ga0466705_525731 Ga0466705_525731_6536_7921 425
112 3300042616 Ga0466715_140625 Ga0466715_140625_1593_2900 425
113 3300042655 Ga0466727_134172 Ga0466727_134172_255_1616 425
114 3300010167 Ga0123353_10046275 Ga0123353_100462753 426
115 3300042591 Ga0466692_111799 Ga0466692_111799_414_1694 426
116 3300042609 Ga0466722_031083 Ga0466722_031083_26314_27594 426
117 3300042616 Ga0466715_013788 Ga0466715_013788_616_1986 426
118 3300042618 Ga0466723_080092 Ga0466723_080092_4261_5541 426
119 3300042643 Ga0466704_297862 Ga0466704_297862_1431_2741 426
120 3300042652 Ga0466708_007489 Ga0466708_007489_14416_15696 426
121 iso_pr_bacteria 2781125697 2781443712 426
122 3300002449 JGI24698J34947_10017310 JGI24698J34947_100173103 427
123 3300002462 JGI24702J35022_10019335 JGI24702J35022_100193352 427
124 3300041968 Ga0456237_0001356 Ga0456237_0001356_2205_3488 427
125 3300042594 Ga0466694_124255 Ga0466694_124255_1016_2299 427
126 3300042614 Ga0466712_102687 Ga0466712_102687_180_1463 427
127 3300042593 Ga0466691_129862 Ga0466691_129862_18423_19709 428
128 3300042607 Ga0466720_097759 Ga0466720_097759_12248_13549 428
129 3300042616 Ga0466715_142809 Ga0466715_142809_6526_7842 428
130 3300000089 AustNasuHG_c1001027 AustNasuHG_10010277 429
131 3300000089 AustNasuHG_c1002449 AustNasuHG_10024496 429
132 3300042590 Ga0466690_144218 Ga0466690_144218_4491_5780 429
133 3300042606 Ga0466719_544255 Ga0466719_544255_11946_13235 429
134 3300042607 Ga0466720_071539 Ga0466720_071539_13459_14748 429
135 3300042609 Ga0466722_035441 Ga0466722_035441_9739_11028 429
136 3300042618 Ga0466723_112988 Ga0466723_112988_8252_9541 429
137 3300042619 Ga0466726_382659 Ga0466726_382659_11844_13133 429
138 3300042636 Ga0466703_187864 Ga0466703_187864_41315_42604 429
139 3300042643 Ga0466704_063886 Ga0466704_063886_3412_4701 429
140 3300042648 Ga0466709_402198 Ga0466709_402198_6559_7848 429
141 iso_pr_bacteria 2781125637 2781282552 429
142 iso_pr_bacteria 2781125649 2781307310 429
143 iso_pr_bacteria 2819992462 2819994156 429
144 iso_pr_bacteria 2820020240 2820020825 429
145 3300042591 Ga0466692_201021 Ga0466692_201021_558_1850 430
146 3300042596 Ga0466696_331190 Ga0466696_331190_11545_12837 430
147 3300002462 JGI24702J35022_10027628 JGI24702J35022_100276282 431
148 3300042616 Ga0466715_462513 Ga0466715_462513_6956_8275 431
149 3300042618 Ga0466723_199918 Ga0466723_199918_6089_7408 431
150 iso_pr_bacteria 2781125690 2781427554 431
151 3300042612 Ga0466705_007122 Ga0466705_007122_8235_9533 432
152 3300042608 Ga0466721_025519 Ga0466721_025519_1975_3276 433
153 3300042614 Ga0466712_274858 Ga0466712_274858_8280_9581 433
154 3300042616 Ga0466715_301038 Ga0466715_301038_9927_11228 433
155 3300042643 Ga0466704_170845 Ga0466704_170845_18_1322 434
156 3300002449 JGI24698J34947_10017971 JGI24698J34947_100179713 435
157 3300042596 Ga0466696_376400 Ga0466696_376400_1689_2996 435
158 iso_pr_bacteria 2781125656 2781320549 435
159 3300009826 Ga0123355_10023236 Ga0123355_100232364 436
160 3300010167 Ga0123353_10423597 Ga0123353_104235971 436
161 3300042594 Ga0466694_031525 Ga0466694_031525_25150_26463 437
162 3300042605 Ga0466716_023523 Ga0466716_023523_7492_8805 437
163 3300010167 Ga0123353_10369067 Ga0123353_103690672 439
164 iso_pr_bacteria 650716099 650879295 439
165 3300010167 Ga0123353_10195972 Ga0123353_101959722 440
166 3300042593 Ga0466691_182649 Ga0466691_182649_10242_11564 440
167 3300042612 Ga0466705_209789 Ga0466705_209789_27044_28378 444
168 3300042636 Ga0466703_087402 Ga0466703_087402_24173_25507 444
169 3300042643 Ga0466704_120913 Ga0466704_120913_15834_17168 444
170 3300042593 Ga0466691_006370 Ga0466691_006370_11147_12490 447
171 3300042643 Ga0466704_556679 Ga0466704_556679_47752_49098 448
172 iso_pr_bacteria 2781125666 2781343428 451
173 3300042606 Ga0466719_023777 Ga0466719_023777_22159_23523 454
174 3300042636 Ga0466703_093126 Ga0466703_093126_9396_10772 458
175 3300042596 Ga0466696_397462 Ga0466696_397462_979_2403 474

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00448 SRP54 SRP54-type protein, GTPase domain 251 443 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.63 0.77 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.