Protein Family IF05230

Metagenome Isolate
157 Members
41 Samples
154 Scaffolds
258.52 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_345523|Ga0466696_345523_9330_10223
Length
297 aa
Sequence
MIANIRRFGNGGTRRVRAVETPCPRLVMEGEGIYSVFMRILSWNVNGIRAVEKRGFVSWLAGESPDVLCLQETKAHPDQLSAELISPQSASGDQYTSYWASAQKKGYSGVAVYSRIKPLNLKTRGIEEFDREGRVLQAEFEDFTLISAYFPNSQDGGARLGYKLDFCAAMLELCNTLAAAGRHFVLCGDYNIAHTPIDLARPKENEGNAGYLPEERAWMDAYTAAGHVDTFRHFHPGQGGHYSWWSYRAGARARNVGWRLDYHCVDRAFLPRIRSSIIRPDVGGSDHCPVQIEIKAR

📊 Sample Types

Isolate 1.9%
Metagenome 98.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.3%
Kalotermitidae 34.1%
Unclassified 7.3%
Rhinotermitidae 7.3%
Termopsidae 4.9%

🌳 Taxonomy

Archaea 0
Bacteria 152
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
2 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
3 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
4 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
5 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
6 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
7 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
18 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
19 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
22 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
34 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
37 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466731_250435 3300042622 Bacteria 10404
2 Ga0466704_313669 3300042643 Bacteria 6648
3 Ga0466708_119546 3300042652 Bacteria 3448
4 Ga0466727_232891 3300042655 Bacteria 9080
5 Ga0466715_150653 3300042616 Bacteria 4096
6 Ga0466715_576323 3300042616 Bacteria 4655
7 Ga0466726_020940 3300042619 Bacteria 3250
8 Ga0466726_174392 3300042619 Bacteria 2496
9 Ga0466728_070228 3300042620 Bacteria 9479
10 Ga0466700_193849 3300042600 Bacteria 35866
11 Ga0466717_012199 3300042604 Bacteria 1194
12 Ga0466719_037913 3300042606 Bacteria 4343
13 Ga0466719_372512 3300042606 Bacteria 6076
14 Ga0466720_034222 3300042607 Bacteria 5430
15 Ga0466720_035609 3300042607 Bacteria 50299
16 Ga0466721_355839 3300042608 Bacteria 31930
17 Ga0415639_006396 3300038395 Bacteria 4892
18 Ga0466690_147652 3300042590 Bacteria 2308
19 Ga0466690_224907 3300042590 Bacteria 1556
20 Ga0466691_009693 3300042593 Bacteria 32026
21 Ga0466696_124476 3300042596 Bacteria 5235
22 JGI24698J34947_10003969 3300002449 Bacteria 8047
23 JGI24695J34938_10041403 3300002450 Bacteria 2068
24 Ga0466705_019469 3300042612 Bacteria 3236
25 Ga0466705_270355 3300042612 Bacteria 2202
26 Ga0466731_279652 3300042622 Bacteria 1375
27 Ga0466709_205886 3300042648 Bacteria 2928
28 Ga0466727_091059 3300042655 Bacteria 4679
29 Ga0466727_118057 3300042655 Bacteria 2162
30 Ga0466712_190974 3300042614 Bacteria 38196
31 Ga0466715_144070 3300042616 Bacteria 26077
32 Ga0466723_175764 3300042618 Bacteria 13311
33 Ga0466723_207644 3300042618 Bacteria 1877
34 Ga0466726_183593 3300042619 Bacteria 1676
35 Ga0466728_353307 3300042620 Bacteria 4360
36 Ga0466728_354183 3300042620 Unclassified 2298
37 Ga0123356_10580294 3300010049 Bacteria 1284
38 Ga0466716_131138 3300042605 Bacteria 4854
39 Ga0466720_030592 3300042607 Bacteria 15558
40 Ga0466722_022732 3300042609 Bacteria 1965
41 Ga0466722_194170 3300042609 Bacteria 4835
42 Ga0466722_263451 3300042609 Bacteria 3280
43 Ga0466698_511560 3300042610 Bacteria 1293
44 Ga0466690_141739 3300042590 Bacteria 4215
45 Ga0466691_048435 3300042593 Bacteria 5537
46 JGI24695J34938_10000802 3300002450 Bacteria 29173
47 JGI24695J34938_10040913 3300002450 Bacteria 2084
48 Ga0466703_116357 3300042636 Bacteria 4709
49 Ga0466703_121549 3300042636 Bacteria 10488
50 Ga0466704_024949 3300042643 Bacteria 10853
51 Ga0466709_285098 3300042648 Bacteria 15718
52 Ga0466727_233743 3300042655 Bacteria 1255
53 Ga0466723_028558 3300042618 Bacteria 1054
54 Ga0466723_095891 3300042618 Bacteria 3992
55 Ga0466723_103018 3300042618 Bacteria 6515
56 Ga0123356_10008846 3300010049 Bacteria 9970
57 Ga0466720_103332 3300042607 Bacteria 19536
58 Ga0466722_123041 3300042609 Bacteria 3613
59 Ga0466696_121563 3300042596 Bacteria 3864
60 JGI24698J34947_10016809 3300002449 Bacteria 3969
61 JGI24698J34947_10035208 3300002449 Bacteria 2616
62 JGI24695J34938_10000071 3300002450 Bacteria 85834
63 Ga0466703_007398 3300042636 Bacteria 2190
64 Ga0466703_369341 3300042636 Bacteria 1249
65 Ga0466708_246361 3300042652 Bacteria 4207
66 Ga0466718_036289 3300042617 Bacteria 1290
67 Ga0466718_083400 3300042617 Bacteria 10236
68 Ga0466723_080631 3300042618 Bacteria 17818
69 Ga0466723_086929 3300042618 Bacteria 10928
70 Ga0466728_019829 3300042620 Bacteria 7158
71 Ga0466728_209378 3300042620 Bacteria 2774
72 Ga0123356_10037504 3300010049 Bacteria 4521
73 Ga0466722_097587 3300042609 Bacteria 9314
74 Ga0466699_005819 3300042597 Bacteria 3017
75 JGI24695J34938_10000391 3300002450 Bacteria 43169
76 JGI24695J34938_10000507 3300002450 Bacteria 37871
77 JGI24695J34938_10001812 3300002450 Bacteria 17459
78 Ga0466732_146338 3300042656 Bacteria 27148
79 Ga0466704_312200 3300042643 Bacteria 21732
80 Ga0466708_114067 3300042652 Bacteria 17228
81 Ga0466727_171479 3300042655 Bacteria 3580
82 Ga0466705_460934 3300042612 Bacteria 6920
83 Ga0466705_495037 3300042612 Bacteria 3822
84 Ga0466711_317584 3300042615 Bacteria 1565
85 Ga0466715_214076 3300042616 Bacteria 7674
86 Ga0466726_083972 3300042619 Bacteria 2061
87 Ga0466728_296618 3300042620 Bacteria 5191
88 Ga0123356_10012150 3300010049 Bacteria 8369
89 Ga0123353_10330307 3300010167 Bacteria 2308
90 Ga0466719_159869 3300042606 Bacteria 2900
91 Ga0466719_523903 3300042606 Bacteria 4752
92 Ga0466720_109732 3300042607 Bacteria 9099
93 Ga0466720_165845 3300042607 Bacteria 11928
94 Ga0466722_062823 3300042609 Bacteria 9032
95 Ga0466690_068180 3300042590 Unclassified 1534
96 JGI24698J34947_10060050 3300002449 Unclassified 1877
97 JGI24698J34947_10065912 3300002449 Bacteria 1764
98 JGI24695J34938_10016936 3300002450 Bacteria 3690
99 Ga0466731_322815 3300042622 Bacteria 1149
100 Ga0466703_198429 3300042636 Unclassified 4828
101 Ga0466727_203387 3300042655 Unclassified 3191
102 Ga0466727_203874 3300042655 Bacteria 2510
103 Ga0466712_165940 3300042614 Bacteria 1135
104 Ga0466711_097500 3300042615 Bacteria 8976
105 Ga0466715_257439 3300042616 Bacteria 4424
106 Ga0466726_018650 3300042619 Bacteria 3657
107 Ga0123356_11064644 3300010049 Bacteria 978
108 Ga0466721_219001 3300042608 Bacteria 1459
109 Ga0466694_020366 3300042594 Bacteria 2708
110 Ga0466694_053284 3300042594 Bacteria 9886
111 Ga0466694_059516 3300042594 Bacteria 1742
112 Ga0466694_120227 3300042594 Bacteria 1909
113 Ga0466694_239170 3300042594 Bacteria 3026
114 Ga0466696_173994 3300042596 Bacteria 3673
115 Ga0466696_377808 3300042596 Bacteria 10732
116 JGI24698J34947_10019464 3300002449 Bacteria 3661
117 JGI24695J34938_10005105 3300002450 Bacteria 8328
118 JGI24695J34938_10011888 3300002450 Bacteria 4653
119 Ga0466705_025341 3300042612 Bacteria 9526
120 Ga0466705_050793 3300042612 Bacteria 9114
121 Ga0466731_150150 3300042622 Bacteria 73009
122 Ga0466704_135516 3300042643 Bacteria 50760
123 Ga0466708_338235 3300042652 Bacteria 21831
124 Ga0466712_315350 3300042614 Bacteria 11372
125 Ga0466723_148440 3300042618 Bacteria 1481
126 Ga0466729_064403 3300042621 Bacteria 1187
127 Ga0466729_105562 3300042621 Bacteria 1361
128 Ga0123355_10026346 3300009826 Bacteria 9378
129 Ga0466719_241378 3300042606 Bacteria 18710
130 Ga0466719_297604 3300042606 Bacteria 4178
131 Ga0466698_372736 3300042610 Bacteria 1486
132 Ga0466692_003852 3300042591 Bacteria 4749
133 Ga0466692_155112 3300042591 Bacteria 4205
134 Ga0466694_315626 3300042594 Bacteria 5472
135 Ga0466696_031078 3300042596 Bacteria 8182
136 Ga0466696_429630 3300042596 Bacteria 1567
137 JGI24702J35022_10016219 3300002462 Bacteria 4084
138 Ga0466731_369634 3300042622 Bacteria 1324
139 Ga0466704_056475 3300042643 Bacteria 4132
140 Ga0466709_350672 3300042648 Bacteria 2342
141 Ga0466708_054239 3300042652 Bacteria 6066
142 Ga0466727_346017 3300042655 Bacteria 3441
143 Ga0466711_121145 3300042615 Bacteria 20134
144 Ga0466723_031890 3300042618 Bacteria 1804
145 Ga0466726_206607 3300042619 Bacteria 3381
146 Ga0466726_406408 3300042619 Bacteria 2108
147 Ga0466719_503176 3300042606 Bacteria 10374
148 Ga0466698_003197 3300042610 Bacteria 17033
149 Ga0466690_256633 3300042590 Bacteria 4560
150 Ga0466691_111577 3300042593 Bacteria 18596
151 Ga0466696_345523 3300042596 Bacteria 48190
152 AustNasuHG_c1004919 3300000089 Bacteria 4783
153 JGI24695J34938_10000723 3300002450 Bacteria 31147
154 JGI24695J34938_10028391 3300002450 Bacteria 2630

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002449 JGI24698J34947_10003969 JGI24698J34947_100039692 241
2 3300042655 Ga0466727_203387 Ga0466727_203387_1155_1934 241
3 3300002450 JGI24695J34938_10001812 JGI24695J34938_1000181210 245
4 3300042620 Ga0466728_354183 Ga0466728_354183_1177_1914 245
5 3300042622 Ga0466731_250435 Ga0466731_250435_4933_5670 245
6 3300042655 Ga0466727_203874 Ga0466727_203874_1158_1937 245
7 3300000089 AustNasuHG_c1004919 AustNasuHG_10049193 246
8 3300042620 Ga0466728_209378 Ga0466728_209378_1401_2141 246
9 3300042652 Ga0466708_246361 Ga0466708_246361_1752_2492 246
10 3300042612 Ga0466705_019469 Ga0466705_019469_1071_1814 247
11 3300042618 Ga0466723_103018 Ga0466723_103018_5040_5783 247
12 3300042648 Ga0466709_350672 Ga0466709_350672_164_907 247
13 3300042614 Ga0466712_165940 Ga0466712_165940_251_1027 249
14 3300042617 Ga0466718_083400 Ga0466718_083400_4989_5813 250
15 3300042608 Ga0466721_219001 Ga0466721_219001_221_976 251
16 3300042609 Ga0466722_062823 Ga0466722_062823_4778_5533 251
17 3300042648 Ga0466709_285098 Ga0466709_285098_3529_4311 253
18 3300042614 Ga0466712_315350 Ga0466712_315350_10302_11066 254
19 3300002449 JGI24698J34947_10016809 JGI24698J34947_100168094 255
20 3300002449 JGI24698J34947_10035208 JGI24698J34947_100352082 255
21 3300002449 JGI24698J34947_10065912 JGI24698J34947_100659122 255
22 iso_pr_bacteria 2781125642 2781291889 255
23 3300002450 JGI24695J34938_10000802 JGI24695J34938_1000080218 256
24 3300002450 JGI24695J34938_10000071 JGI24695J34938_1000007162 257
25 3300002450 JGI24695J34938_10000391 JGI24695J34938_1000039114 257
26 3300002450 JGI24695J34938_10000507 JGI24695J34938_1000050719 257
27 3300002450 JGI24695J34938_10000723 JGI24695J34938_1000072311 257
28 3300002450 JGI24695J34938_10028391 JGI24695J34938_100283912 257
29 3300010049 Ga0123356_10037504 Ga0123356_100375042 257
30 3300010049 Ga0123356_11064644 Ga0123356_110646441 257
31 3300038395 Ga0415639_006396 Ga0415639_006396_1365_2138 257
32 3300042593 Ga0466691_048435 Ga0466691_048435_4503_5276 257
33 3300042593 Ga0466691_111577 Ga0466691_111577_16702_17475 257
34 3300042596 Ga0466696_377808 Ga0466696_377808_9699_10472 257
35 3300042606 Ga0466719_241378 Ga0466719_241378_749_1522 257
36 3300042610 Ga0466698_003197 Ga0466698_003197_14579_15352 257
37 3300042615 Ga0466711_317584 Ga0466711_317584_22_795 257
38 3300042616 Ga0466715_144070 Ga0466715_144070_480_1253 257
39 3300042636 Ga0466703_198429 Ga0466703_198429_3486_4259 257
40 3300042652 Ga0466708_114067 Ga0466708_114067_6747_7520 257
41 3300010049 Ga0123356_10012150 Ga0123356_100121506 258
42 3300042591 Ga0466692_003852 Ga0466692_003852_3315_4091 258
43 3300042591 Ga0466692_155112 Ga0466692_155112_1911_2687 258
44 3300042594 Ga0466694_059516 Ga0466694_059516_282_1058 258
45 3300042594 Ga0466694_239170 Ga0466694_239170_476_1252 258
46 3300042594 Ga0466694_315626 Ga0466694_315626_4116_4892 258
47 3300042597 Ga0466699_005819 Ga0466699_005819_1074_1850 258
48 3300042600 Ga0466700_193849 Ga0466700_193849_22921_23697 258
49 3300042604 Ga0466717_012199 Ga0466717_012199_367_1143 258
50 3300042607 Ga0466720_034222 Ga0466720_034222_195_971 258
51 3300042607 Ga0466720_103332 Ga0466720_103332_16347_17123 258
52 3300042607 Ga0466720_165845 Ga0466720_165845_7655_8431 258
53 3300042609 Ga0466722_022732 Ga0466722_022732_355_1131 258
54 3300042609 Ga0466722_123041 Ga0466722_123041_165_941 258
55 3300042609 Ga0466722_194170 Ga0466722_194170_1874_2650 258
56 3300042609 Ga0466722_263451 Ga0466722_263451_911_1687 258
57 3300042610 Ga0466698_372736 Ga0466698_372736_452_1228 258
58 3300042610 Ga0466698_511560 Ga0466698_511560_259_1035 258
59 3300042614 Ga0466712_190974 Ga0466712_190974_32315_33091 258
60 3300042617 Ga0466718_036289 Ga0466718_036289_200_976 258
61 3300042622 Ga0466731_369634 Ga0466731_369634_218_994 258
62 3300042655 Ga0466727_232891 Ga0466727_232891_3899_4675 258
63 3300042656 Ga0466732_146338 Ga0466732_146338_13735_14511 258
64 iso_pr_bacteria 2781125696 2781441373 258
65 3300002449 JGI24698J34947_10019464 JGI24698J34947_100194642 259
66 3300002449 JGI24698J34947_10060050 JGI24698J34947_100600503 259
67 3300002450 JGI24695J34938_10040913 JGI24695J34938_100409132 259
68 3300002450 JGI24695J34938_10041403 JGI24695J34938_100414033 259
69 3300002462 JGI24702J35022_10016219 JGI24702J35022_100162195 259
70 3300009826 Ga0123355_10026346 Ga0123355_100263465 259
71 3300010049 Ga0123356_10580294 Ga0123356_105802942 259
72 3300042590 Ga0466690_147652 Ga0466690_147652_1080_1859 259
73 3300042590 Ga0466690_256633 Ga0466690_256633_3074_3853 259
74 3300042596 Ga0466696_429630 Ga0466696_429630_709_1488 259
75 3300042606 Ga0466719_037913 Ga0466719_037913_2382_3161 259
76 3300042606 Ga0466719_297604 Ga0466719_297604_2240_3019 259
77 3300042606 Ga0466719_523903 Ga0466719_523903_2958_3737 259
78 3300042608 Ga0466721_355839 Ga0466721_355839_12169_12948 259
79 3300042612 Ga0466705_495037 Ga0466705_495037_2773_3552 259
80 3300042616 Ga0466715_257439 Ga0466715_257439_252_1031 259
81 3300042618 Ga0466723_028558 Ga0466723_028558_254_1033 259
82 3300042618 Ga0466723_031890 Ga0466723_031890_866_1645 259
83 3300042618 Ga0466723_080631 Ga0466723_080631_4739_5518 259
84 3300042618 Ga0466723_095891 Ga0466723_095891_1981_2760 259
85 3300042619 Ga0466726_083972 Ga0466726_083972_504_1283 259
86 3300042619 Ga0466726_174392 Ga0466726_174392_1020_1799 259
87 3300042619 Ga0466726_406408 Ga0466726_406408_1314_2093 259
88 3300042620 Ga0466728_353307 Ga0466728_353307_2447_3226 259
89 3300042622 Ga0466731_150150 Ga0466731_150150_30227_31006 259
90 3300042636 Ga0466703_369341 Ga0466703_369341_80_859 259
91 3300042643 Ga0466704_056475 Ga0466704_056475_3234_4013 259
92 3300042655 Ga0466727_091059 Ga0466727_091059_2828_3607 259
93 3300002450 JGI24695J34938_10005105 JGI24695J34938_100051056 260
94 3300042590 Ga0466690_068180 Ga0466690_068180_720_1502 260
95 3300042590 Ga0466690_224907 Ga0466690_224907_310_1092 260
96 3300042593 Ga0466691_009693 Ga0466691_009693_26013_26795 260
97 3300042594 Ga0466694_020366 Ga0466694_020366_552_1334 260
98 3300042596 Ga0466696_031078 Ga0466696_031078_3794_4576 260
99 3300042596 Ga0466696_121563 Ga0466696_121563_979_1761 260
100 3300042596 Ga0466696_173994 Ga0466696_173994_660_1442 260
101 3300042605 Ga0466716_131138 Ga0466716_131138_3927_4709 260
102 3300042606 Ga0466719_159869 Ga0466719_159869_1196_1978 260
103 3300042606 Ga0466719_372512 Ga0466719_372512_4527_5309 260
104 3300042612 Ga0466705_050793 Ga0466705_050793_2631_3413 260
105 3300042612 Ga0466705_270355 Ga0466705_270355_865_1647 260
106 3300042612 Ga0466705_460934 Ga0466705_460934_1990_2772 260
107 3300042616 Ga0466715_214076 Ga0466715_214076_4923_5705 260
108 3300042616 Ga0466715_576323 Ga0466715_576323_3784_4566 260
109 3300042618 Ga0466723_086929 Ga0466723_086929_2729_3511 260
110 3300042618 Ga0466723_148440 Ga0466723_148440_369_1151 260
111 3300042618 Ga0466723_175764 Ga0466723_175764_9210_9992 260
112 3300042620 Ga0466728_019829 Ga0466728_019829_5954_6736 260
113 3300042620 Ga0466728_070228 Ga0466728_070228_8630_9412 260
114 3300042620 Ga0466728_296618 Ga0466728_296618_433_1215 260
115 3300042621 Ga0466729_064403 Ga0466729_064403_40_822 260
116 3300042622 Ga0466731_322815 Ga0466731_322815_135_917 260
117 3300042636 Ga0466703_007398 Ga0466703_007398_993_1775 260
118 3300042636 Ga0466703_116357 Ga0466703_116357_2817_3599 260
119 3300042636 Ga0466703_121549 Ga0466703_121549_6048_6830 260
120 3300042643 Ga0466704_024949 Ga0466704_024949_5711_6493 260
121 3300042643 Ga0466704_313669 Ga0466704_313669_2326_3108 260
122 3300042652 Ga0466708_054239 Ga0466708_054239_4609_5391 260
123 3300042655 Ga0466727_171479 Ga0466727_171479_668_1450 260
124 3300010049 Ga0123356_10008846 Ga0123356_100088462 261
125 3300042594 Ga0466694_120227 Ga0466694_120227_44_829 261
126 3300042596 Ga0466696_124476 Ga0466696_124476_2366_3151 261
127 3300042612 Ga0466705_025341 Ga0466705_025341_4986_5771 261
128 3300042615 Ga0466711_121145 Ga0466711_121145_3823_4608 261
129 3300042619 Ga0466726_183593 Ga0466726_183593_116_901 261
130 3300042643 Ga0466704_135516 Ga0466704_135516_664_1449 261
131 3300042652 Ga0466708_338235 Ga0466708_338235_16210_16995 261
132 3300042607 Ga0466720_109732 Ga0466720_109732_8163_8951 262
133 3300042616 Ga0466715_150653 Ga0466715_150653_580_1368 262
134 3300042619 Ga0466726_018650 Ga0466726_018650_1556_2344 262
135 3300042619 Ga0466726_020940 Ga0466726_020940_1575_2363 262
136 3300042619 Ga0466726_206607 Ga0466726_206607_2418_3206 262
137 3300042643 Ga0466704_312200 Ga0466704_312200_5202_5990 262
138 3300042655 Ga0466727_118057 Ga0466727_118057_171_959 262
139 3300042655 Ga0466727_233743 Ga0466727_233743_173_961 262
140 3300042655 Ga0466727_346017 Ga0466727_346017_2299_3087 262
141 3300042606 Ga0466719_503176 Ga0466719_503176_7671_8462 263
142 3300042607 Ga0466720_035609 Ga0466720_035609_34620_35411 263
143 3300042609 Ga0466722_097587 Ga0466722_097587_1658_2449 263
144 3300042618 Ga0466723_207644 Ga0466723_207644_134_925 263
145 3300042652 Ga0466708_119546 Ga0466708_119546_1571_2362 263
146 3300002450 JGI24695J34938_10011888 JGI24695J34938_100118882 265
147 3300002450 JGI24695J34938_10016936 JGI24695J34938_100169362 265
148 3300010167 Ga0123353_10330307 Ga0123353_103303071 265
149 3300042594 Ga0466694_053284 Ga0466694_053284_6301_7098 265
150 3300042607 Ga0466720_030592 Ga0466720_030592_4300_5097 265
151 3300042615 Ga0466711_097500 Ga0466711_097500_7875_8672 265
152 3300042621 Ga0466729_105562 Ga0466729_105562_328_1128 266
153 iso_pr_bacteria 2781125633 2781273121 267
154 3300042622 Ga0466731_279652 Ga0466731_279652_283_1092 269
155 3300042590 Ga0466690_141739 Ga0466690_141739_1954_2766 270
156 3300042648 Ga0466709_205886 Ga0466709_205886_550_1362 270
157 3300042596 Ga0466696_345523 Ga0466696_345523_9330_10223 297

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 41 287 0.89

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03372 GO:0003824 catalytic activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.