Protein Family IF05209

Metagenome Isolate
139 Members
55 Samples
130 Scaffolds
141.22 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_297252|Ga0466696_297252_405_914
Length
169 aa
Sequence
VSFSDEKLERSTLTKHIKSILYLSGGKSKMMKNPAETIGNLIEKQGISFISSIDENGYPNTKAMLPPVKREGIKTFYWHTNSPSMRIKHYRNNPKACIYFYDKRFFRGVMLKGTMEVLDDRKVKKELWKDEFTTYYKDGMDGGDFIIIKFTAEDGRYYSNFHSEDFKIE

πŸ“Š Sample Types

Isolate 6.5%
Metagenome 93.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 51.9%
Kalotermitidae 22.2%
Unclassified 20.4%
Rhinotermitidae 3.7%
Termopsidae 1.9%

🌳 Taxonomy

Archaea 3
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 19

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
13 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
23 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
24 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
25 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
26 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
27 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
33 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
34 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
35 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 2820016619 Unclassified Spirochaetes Nt197P3bin71 Isolate Unclassified
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
41 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
42 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
43 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
44 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
45 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
46 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
47 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
48 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
49 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
50 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
51 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
52 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
53 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_035333 3300042612 Bacteria 17587
2 Ga0466733_026125 3300042659 Bacteria 5789
3 JGI24698J34947_10109212 3300002449 Bacteria 1225
4 JGI24702J35022_10029297 3300002462 Unclassified 2955
5 Ga0123356_13454333 3300010049 Bacteria 548
6 Ga0123354_10313036 3300010882 Bacteria 1462
7 Ga0466693_439729 3300042592 Bacteria 2347
8 Ga0466694_153287 3300042594 Unclassified 2273
9 Ga0466694_257468 3300042594 Bacteria 3093
10 JGI24702J35022_10498515 3300002462 Bacteria 746
11 Ga0072941_1033444 3300005201 Bacteria 1119
12 Ga0466719_058671 3300042606 Bacteria 1987
13 Ga0466719_331645 3300042606 Bacteria 1046
14 Ga0466712_175202 3300042614 Archaea 1879
15 Ga0466712_257943 3300042614 Bacteria 1048
16 Ga0466712_308374 3300042614 Bacteria 1205
17 Ga0466715_644943 3300042616 Unclassified 1851
18 Ga0466718_053412 3300042617 Bacteria 1862
19 Ga0466723_003472 3300042618 Bacteria 2638
20 Ga0466726_215141 3300042619 Bacteria 1337
21 Ga0123353_10184475 3300010167 Unclassified 3300
22 Ga0466690_132358 3300042590 Unclassified 6041
23 Ga0466693_189590 3300042592 Archaea 1448
24 Ga0466691_054270 3300042593 Bacteria 2680
25 Ga0466694_308555 3300042594 Bacteria 1099
26 Ga0466696_336620 3300042596 Bacteria 1455
27 Ga0466699_095417 3300042597 Bacteria 3901
28 Ga0466699_139225 3300042597 Bacteria 1148
29 Ga0466734_085032 3300042623 Bacteria 1068
30 Ga0466703_216800 3300042636 Bacteria 8457
31 Ga0466709_289692 3300042648 Bacteria 1437
32 JGI24698J34947_10016990 3300002449 Archaea 3947
33 JGI24698J34947_10222174 3300002449 Unclassified 724
34 JGI24702J35022_10077980 3300002462 Bacteria 1792
35 JGI24702J35022_10311619 3300002462 Bacteria 931
36 JGI24697J35500_10700309 3300002507 Bacteria 640
37 JGI24696J40584_12958384 3300002834 Bacteria 4094
38 Ga0466707_149048 3300042601 Bacteria 1368
39 Ga0466717_103462 3300042604 Bacteria 1800
40 Ga0466719_000679 3300042606 Unclassified 1389
41 Ga0466719_087147 3300042606 Bacteria 1066
42 Ga0466712_005377 3300042614 Bacteria 7270
43 Ga0466712_144401 3300042614 Unclassified 3986
44 Ga0466711_452005 3300042615 Bacteria 1602
45 Ga0466715_335955 3300042616 Bacteria 1119
46 Ga0123356_10423313 3300010049 Bacteria 1474
47 Ga0466693_236615 3300042592 Unclassified 3304
48 Ga0466694_009587 3300042594 Bacteria 21066
49 Ga0466703_229004 3300042636 Bacteria 1764
50 Ga0466704_531763 3300042643 Bacteria 1183
51 Ga0466733_076681 3300042659 Bacteria 6510
52 JGI24698J34947_10031792 3300002449 Bacteria 2775
53 JGI24698J34947_10043205 3300002449 Bacteria 2312
54 JGI24702J35022_10000819 3300002462 Bacteria 19235
55 JGI24697J35500_11265636 3300002507 Unclassified 3428
56 Ga0072940_1014448 3300005200 Bacteria 1854
57 Ga0466701_071740 3300042598 Bacteria 1140
58 Ga0466720_055863 3300042607 Bacteria 2676
59 Ga0466698_013164 3300042610 Bacteria 1520
60 Ga0466698_083134 3300042610 Bacteria 2475
61 Ga0466712_011783 3300042614 Bacteria 1692
62 Ga0466712_121311 3300042614 Bacteria 5172
63 Ga0466712_303795 3300042614 Bacteria 2278
64 Ga0466715_143170 3300042616 Bacteria 3889
65 Ga0466728_308725 3300042620 Bacteria 3280
66 Ga0466691_007521 3300042593 Bacteria 9142
67 Ga0466694_189530 3300042594 Bacteria 2251
68 Ga0466696_196626 3300042596 Bacteria 7243
69 Ga0466709_246949 3300042648 Bacteria 8687
70 JGI24695J34938_10009290 3300002450 Bacteria 5481
71 JGI24695J34938_10121562 3300002450 Bacteria 1063
72 JGI24699J35502_11128913 3300002509 Unclassified 4541
73 Ga0466698_043363 3300042610 Bacteria 1509
74 Ga0466698_516225 3300042610 Bacteria 1060
75 Ga0466712_028702 3300042614 Bacteria 2196
76 Ga0466718_002292 3300042617 Bacteria 2946
77 Ga0466718_166815 3300042617 Bacteria 4285
78 Ga0456237_0033414 3300041968 Bacteria 687
79 Ga0466732_434304 3300042656 Bacteria 1566
80 JGI24698J34947_10065782 3300002449 Unclassified 1766
81 JGI24698J34947_10110238 3300002449 Unclassified 1217
82 JGI24698J34947_10152774 3300002449 Bacteria 956
83 JGI24702J35022_10015273 3300002462 Bacteria 4231
84 JGI24705J35276_12200537 3300002504 Bacteria 1603
85 Ga0072941_1043313 3300005201 Bacteria 3334
86 Ga0466717_036076 3300042604 Bacteria 3294
87 Ga0466721_015084 3300042608 Bacteria 2297
88 Ga0466718_113510 3300042617 Bacteria 1072
89 Ga0466723_251345 3300042618 Bacteria 1071
90 Ga0123356_10000360 3300010049 Bacteria 51711
91 Ga0466692_137524 3300042591 Bacteria 1036
92 Ga0466701_013677 3300042598 Bacteria 1780
93 AustNasuHG_c1030442 3300000089 Unclassified 1553
94 JGI24695J34938_10158308 3300002450 Bacteria 930
95 JGI24702J35022_10003830 3300002462 Unclassified 9025
96 JGI24702J35022_10033274 3300002462 Bacteria 2758
97 JGI24705J35276_12194035 3300002504 Bacteria 1506
98 JGI24705J35276_12212753 3300002504 Bacteria 1900
99 JGI24696J40584_12577695 3300002834 Bacteria 642
100 Ga0068305_10017923 3300005083 Bacteria 2994
101 Ga0466700_268441 3300042600 Bacteria 1633
102 Ga0466707_355149 3300042601 Bacteria 1083
103 Ga0466717_091590 3300042604 Bacteria 2081
104 Ga0466719_012761 3300042606 Bacteria 8310
105 Ga0466698_348492 3300042610 Bacteria 1314
106 Ga0466712_021946 3300042614 Bacteria 5962
107 Ga0466712_046367 3300042614 Bacteria 2653
108 Ga0466712_208852 3300042614 Bacteria 6962
109 Ga0466712_303060 3300042614 Unclassified 1744
110 Ga0466718_134056 3300042617 Unclassified 4509
111 Ga0123353_11764501 3300010167 Bacteria 771
112 Ga0466691_135897 3300042593 Bacteria 2280
113 Ga0466696_008377 3300042596 Bacteria 8659
114 Ga0466696_297252 3300042596 Bacteria 1176
115 Ga0466699_282273 3300042597 Bacteria 1300
116 Ga0466731_299525 3300042622 Bacteria 1641
117 Ga0466703_295610 3300042636 Bacteria 1437
118 JGI24698J34947_10043196 3300002449 Bacteria 2312
119 JGI24695J34938_10064123 3300002450 Bacteria 1555
120 JGI24702J35022_10357305 3300002462 Bacteria 874
121 JGI24705J35276_12097206 3300002504 Bacteria 1009
122 Ga0466698_396596 3300042610 Bacteria 1640
123 Ga0466710_228966 3300042613 Bacteria 1113
124 Ga0466711_484952 3300042615 Bacteria 1132
125 Ga0466715_193277 3300042616 Bacteria 9457
126 Ga0123353_10488997 3300010167 Unclassified 1798
127 Ga0466692_192402 3300042591 Bacteria 1474
128 Ga0466694_185859 3300042594 Bacteria 9745
129 Ga0466696_305177 3300042596 Unclassified 2026
130 Ga0466703_206285 3300042636 Bacteria 1717

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042594 Ga0466694_153287 Ga0466694_153287_689_1105 138
2 3300042597 Ga0466699_095417 Ga0466699_095417_2214_2630 138
3 3300042604 Ga0466717_036076 Ga0466717_036076_2490_2906 138
4 3300042615 Ga0466711_452005 Ga0466711_452005_208_624 138
5 3300010167 Ga0123353_10488997 Ga0123353_104889972 139
6 3300042594 Ga0466694_009587 Ga0466694_009587_8106_8525 139
7 3300042598 Ga0466701_013677 Ga0466701_013677_686_1105 139
8 3300042614 Ga0466712_021946 Ga0466712_021946_5150_5569 139
9 3300042614 Ga0466712_121311 Ga0466712_121311_705_1124 139
10 3300042617 Ga0466718_002292 Ga0466718_002292_1112_1531 139
11 3300042617 Ga0466718_053412 Ga0466718_053412_209_628 139
12 3300042617 Ga0466718_166815 Ga0466718_166815_1500_1919 139
13 3300042622 Ga0466731_299525 Ga0466731_299525_99_518 139
14 3300042648 Ga0466709_289692 Ga0466709_289692_382_801 139
15 3300042659 Ga0466733_076681 Ga0466733_076681_2943_3362 139
16 iso_pr_bacteria 2781125629 2781264302 139
17 3300002449 JGI24698J34947_10016990 JGI24698J34947_100169903 140
18 3300002449 JGI24698J34947_10031792 JGI24698J34947_100317922 140
19 3300002449 JGI24698J34947_10043196 JGI24698J34947_100431963 140
20 3300002449 JGI24698J34947_10065782 JGI24698J34947_100657822 140
21 3300002449 JGI24698J34947_10109212 JGI24698J34947_101092122 140
22 3300002449 JGI24698J34947_10152774 JGI24698J34947_101527742 140
23 3300002462 JGI24702J35022_10015273 JGI24702J35022_100152732 140
24 3300002462 JGI24702J35022_10357305 JGI24702J35022_103573051 140
25 3300002504 JGI24705J35276_12200537 JGI24705J35276_122005371 140
26 3300002509 JGI24699J35502_11128913 JGI24699J35502_111289134 140
27 3300002834 JGI24696J40584_12577695 JGI24696J40584_125776952 140
28 3300002834 JGI24696J40584_12958384 JGI24696J40584_129583844 140
29 3300005201 Ga0072941_1033444 Ga0072941_10334442 140
30 3300010049 Ga0123356_10423313 Ga0123356_104233133 140
31 3300010167 Ga0123353_11764501 Ga0123353_117645012 140
32 3300042591 Ga0466692_137524 Ga0466692_137524_414_836 140
33 3300042591 Ga0466692_192402 Ga0466692_192402_422_844 140
34 3300042592 Ga0466693_189590 Ga0466693_189590_152_574 140
35 3300042592 Ga0466693_439729 Ga0466693_439729_333_755 140
36 3300042593 Ga0466691_007521 Ga0466691_007521_1119_1541 140
37 3300042593 Ga0466691_054270 Ga0466691_054270_1927_2349 140
38 3300042594 Ga0466694_189530 Ga0466694_189530_1024_1446 140
39 3300042594 Ga0466694_257468 Ga0466694_257468_1519_1941 140
40 3300042594 Ga0466694_308555 Ga0466694_308555_424_846 140
41 3300042596 Ga0466696_008377 Ga0466696_008377_532_954 140
42 3300042596 Ga0466696_305177 Ga0466696_305177_1158_1580 140
43 3300042596 Ga0466696_336620 Ga0466696_336620_120_542 140
44 3300042597 Ga0466699_139225 Ga0466699_139225_659_1081 140
45 3300042598 Ga0466701_071740 Ga0466701_071740_529_951 140
46 3300042600 Ga0466700_268441 Ga0466700_268441_677_1099 140
47 3300042601 Ga0466707_149048 Ga0466707_149048_512_934 140
48 3300042601 Ga0466707_355149 Ga0466707_355149_257_679 140
49 3300042604 Ga0466717_091590 Ga0466717_091590_133_555 140
50 3300042606 Ga0466719_000679 Ga0466719_000679_133_555 140
51 3300042606 Ga0466719_012761 Ga0466719_012761_2906_3328 140
52 3300042606 Ga0466719_087147 Ga0466719_087147_455_877 140
53 3300042606 Ga0466719_331645 Ga0466719_331645_473_895 140
54 3300042607 Ga0466720_055863 Ga0466720_055863_2097_2519 140
55 3300042610 Ga0466698_013164 Ga0466698_013164_199_621 140
56 3300042610 Ga0466698_043363 Ga0466698_043363_946_1368 140
57 3300042610 Ga0466698_083134 Ga0466698_083134_2004_2426 140
58 3300042610 Ga0466698_396596 Ga0466698_396596_10_432 140
59 3300042610 Ga0466698_516225 Ga0466698_516225_71_493 140
60 3300042612 Ga0466705_035333 Ga0466705_035333_4623_5045 140
61 3300042613 Ga0466710_228966 Ga0466710_228966_89_511 140
62 3300042614 Ga0466712_011783 Ga0466712_011783_373_795 140
63 3300042614 Ga0466712_028702 Ga0466712_028702_1126_1548 140
64 3300042614 Ga0466712_046367 Ga0466712_046367_1079_1501 140
65 3300042614 Ga0466712_144401 Ga0466712_144401_17_439 140
66 3300042614 Ga0466712_175202 Ga0466712_175202_919_1341 140
67 3300042614 Ga0466712_208852 Ga0466712_208852_4225_4647 140
68 3300042614 Ga0466712_257943 Ga0466712_257943_71_493 140
69 3300042614 Ga0466712_303060 Ga0466712_303060_304_726 140
70 3300042614 Ga0466712_303795 Ga0466712_303795_852_1274 140
71 3300042614 Ga0466712_308374 Ga0466712_308374_415_837 140
72 3300042615 Ga0466711_484952 Ga0466711_484952_405_827 140
73 3300042616 Ga0466715_143170 Ga0466715_143170_1913_2335 140
74 3300042616 Ga0466715_193277 Ga0466715_193277_8814_9236 140
75 3300042616 Ga0466715_335955 Ga0466715_335955_172_594 140
76 3300042616 Ga0466715_644943 Ga0466715_644943_947_1369 140
77 3300042617 Ga0466718_113510 Ga0466718_113510_169_591 140
78 3300042617 Ga0466718_134056 Ga0466718_134056_1361_1783 140
79 3300042619 Ga0466726_215141 Ga0466726_215141_654_1076 140
80 3300042620 Ga0466728_308725 Ga0466728_308725_2501_2923 140
81 3300042623 Ga0466734_085032 Ga0466734_085032_401_823 140
82 3300042636 Ga0466703_216800 Ga0466703_216800_5919_6341 140
83 3300042636 Ga0466703_229004 Ga0466703_229004_1299_1721 140
84 3300042636 Ga0466703_295610 Ga0466703_295610_189_611 140
85 3300042648 Ga0466709_246949 Ga0466709_246949_1184_1606 140
86 3300042656 Ga0466732_434304 Ga0466732_434304_941_1363 140
87 iso_pr_bacteria 2781125652 2781312643 140
88 iso_pr_bacteria 2781125689 2781425715 140
89 iso_pr_bacteria 2819998259 2819999396 140
90 iso_pr_bacteria 2820016619 2820017047 140
91 iso_pr_bacteria 2820166269 2820166669 140
92 iso_pr_bacteria 2820170025 2820171682 140
93 iso_pr_bacteria 2820246658 2820247678 140
94 iso_pr_bacteria 2820737921 2820738039 140
95 3300000089 AustNasuHG_c1030442 AustNasuHG_10304423 141
96 3300002449 JGI24698J34947_10110238 JGI24698J34947_101102382 141
97 3300002449 JGI24698J34947_10222174 JGI24698J34947_102221742 141
98 3300002450 JGI24695J34938_10009290 JGI24695J34938_100092905 141
99 3300002450 JGI24695J34938_10064123 JGI24695J34938_100641232 141
100 3300002450 JGI24695J34938_10121562 JGI24695J34938_101215622 141
101 3300002450 JGI24695J34938_10158308 JGI24695J34938_101583081 141
102 3300002462 JGI24702J35022_10000819 JGI24702J35022_1000081911 141
103 3300002462 JGI24702J35022_10003830 JGI24702J35022_100038304 141
104 3300002462 JGI24702J35022_10029297 JGI24702J35022_100292974 141
105 3300002462 JGI24702J35022_10033274 JGI24702J35022_100332742 141
106 3300002462 JGI24702J35022_10077980 JGI24702J35022_100779802 141
107 3300002462 JGI24702J35022_10311619 JGI24702J35022_103116192 141
108 3300002462 JGI24702J35022_10498515 JGI24702J35022_104985151 141
109 3300002504 JGI24705J35276_12097206 JGI24705J35276_120972062 141
110 3300002504 JGI24705J35276_12212753 JGI24705J35276_122127532 141
111 3300002507 JGI24697J35500_10700309 JGI24697J35500_107003091 141
112 3300002507 JGI24697J35500_11265636 JGI24697J35500_112656364 141
113 3300005200 Ga0072940_1014448 Ga0072940_10144482 141
114 3300005201 Ga0072941_1043313 Ga0072941_10433133 141
115 3300010049 Ga0123356_13454333 Ga0123356_134543332 141
116 3300010167 Ga0123353_10184475 Ga0123353_101844751 141
117 3300042590 Ga0466690_132358 Ga0466690_132358_5409_5834 141
118 3300042594 Ga0466694_185859 Ga0466694_185859_2211_2636 141
119 3300042592 Ga0466693_236615 Ga0466693_236615_25_453 142
120 3300042606 Ga0466719_058671 Ga0466719_058671_453_881 142
121 3300042614 Ga0466712_005377 Ga0466712_005377_5679_6107 142
122 3300042643 Ga0466704_531763 Ga0466704_531763_390_818 142
123 3300042659 Ga0466733_026125 Ga0466733_026125_1299_1727 142
124 3300002449 JGI24698J34947_10043205 JGI24698J34947_100432056 143
125 3300002504 JGI24705J35276_12194035 JGI24705J35276_121940352 143
126 3300005083 Ga0068305_10017923 Ga0068305_100179235 143
127 3300041968 Ga0456237_0033414 Ga0456237_0033414_159_596 145
128 3300042593 Ga0466691_135897 Ga0466691_135897_179_616 145
129 3300042597 Ga0466699_282273 Ga0466699_282273_476_913 145
130 3300042604 Ga0466717_103462 Ga0466717_103462_1233_1670 145
131 3300042636 Ga0466703_206285 Ga0466703_206285_814_1251 145
132 3300010882 Ga0123354_10313036 Ga0123354_103130362 147
133 3300042610 Ga0466698_348492 Ga0466698_348492_357_800 147
134 3300042618 Ga0466723_251345 Ga0466723_251345_162_608 148
135 3300010049 Ga0123356_10000360 Ga0123356_100003603 153
136 3300042596 Ga0466696_196626 Ga0466696_196626_1675_2142 155
137 3300042608 Ga0466721_015084 Ga0466721_015084_402_887 161
138 3300042618 Ga0466723_003472 Ga0466723_003472_1003_1488 161
139 3300042596 Ga0466696_297252 Ga0466696_297252_405_914 169

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01243 Putative_PNPOx Pyridoxamine 5'-phosphate oxidase 40 121 0.93
PF16242 Pyrid_ox_like Pyridoxamine 5'-phosphate oxidase like 36 161 0.86

πŸ—οΈ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2fhq-assembly1.cif.gz_B Crystal Structure of General Stress Protein from Bacteroides thetaiotaomicron 0.937 32 168
2hq7-assembly1.cif.gz_B Crystal structure of Protein related to general stress protein 26(GS26) of B.subtilis (pyridoxinephosphate oxidase family) (NP_350077.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.00 A resolution 0.914 40 168
2i02-assembly1.cif.gz_B CRYSTAL STRUCTURE OF a pyridoxamine 5'-phosphate oxidase-like family protein (NPUN_R6570) FROM NOSTOC PUNCTIFORME PCC 73102 AT 1.80 A RESOLUTION 0.893 35 168
2re7-assembly1.cif.gz_A-2 Crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 A resolution 0.886 30 160
3db0-assembly1.cif.gz_B Crystal structure of Putative Pyridoxamine 5'-phosphate oxidase (NP_472219.1) from LISTERIA INNOCUA at 2.00 A resolution 0.835 33 157
IDDescriptionScoreStartEndSuperfamily
2fhqB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9314 33 168 2.30.110.10
2i02B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8845 35 168 2.30.110.10
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8815 30 160 2.30.110.10
2hq7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8751 30 167 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8352 36 159 2.30.110.10
IDDescriptionScoreStartEndGO Terms
AF-A0A3E2EDX8-F1-model_v4 Uncharacterized/unreviewed 0.9813 50 168
AF-A0A6B8RWH2-F1-model_v4 Uncharacterized/unreviewed 0.9699 36 168

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.