Protein Family IF05208

Metagenome Isolate
133 Members
43 Samples
129 Scaffolds
117.95 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_295258|Ga0466696_295258_956_1309
Length
117 aa
Sequence
MEMMKIFVYNMKKYRKKRQLSQMKLAEMINTSTSYIGEIEINSKVPSMEMVEKISKALSVEPFRLFVDNRNDAAVSTDISYLSALSPPERQDLTERLVALIANNVEQLLQPENSPRP

📊 Sample Types

Isolate 3.0%
Metagenome 97.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.3%
Kalotermitidae 31.7%
Unclassified 9.8%
Rhinotermitidae 7.3%
Termopsidae 4.9%

🌳 Taxonomy

Archaea 2
Bacteria 107
Eukaryota 0
Viruses 1
Unclassified 23

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
12 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
13 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
17 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
20 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
21 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
27 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
38 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466692_155266 3300042591 Bacteria 7776
2 Ga0466692_163754 3300042591 Bacteria 17044
3 Ga0466696_138856 3300042596 Unclassified 1669
4 Ga0466718_075735 3300042617 Bacteria 2478
5 Ga0466718_115544 3300042617 Bacteria 8643
6 Ga0466718_165570 3300042617 Bacteria 1955
7 Ga0466723_116834 3300042618 Bacteria 3405
8 Ga0466722_156425 3300042609 Bacteria 5586
9 Ga0466722_157054 3300042609 Bacteria 6132
10 Ga0466722_171142 3300042609 Bacteria 1359
11 Ga0466708_054758 3300042652 Bacteria 4428
12 JGI24698J34947_10041510 3300002449 Bacteria 2369
13 JGI24698J34947_10059175 3300002449 Bacteria 1895
14 JGI24695J34938_10012116 3300002450 Unclassified 4593
15 JGI24695J34938_10229119 3300002450 Unclassified 782
16 Ga0072941_1053635 3300005201 Bacteria 5168
17 Ga0123356_10719585 3300010049 Bacteria 1168
18 Ga0415639_085602 3300038395 Bacteria 1291
19 Ga0415639_103111 3300038395 Unclassified 2350
20 Ga0466692_040510 3300042591 Bacteria 3326
21 Ga0466696_012632 3300042596 Bacteria 8951
22 Ga0466699_378943 3300042597 Unclassified 1112
23 Ga0466712_192655 3300042614 Unclassified 1637
24 Ga0466712_223254 3300042614 Bacteria 1219
25 Ga0466718_095910 3300042617 Bacteria 5701
26 Ga0466728_349741 3300042620 Bacteria 1581
27 Ga0466722_058656 3300042609 Bacteria 1481
28 Ga0466705_188785 3300042612 Bacteria 2250
29 Ga0466704_363625 3300042643 Bacteria 4299
30 Ga0466709_081313 3300042648 Bacteria 4067
31 JGI24695J34938_10000126 3300002450 Bacteria 68489
32 JGI24695J34938_10002907 3300002450 Bacteria 12446
33 JGI24695J34938_10380474 3300002450 Bacteria 626
34 JGI24695J34938_10464237 3300002450 Bacteria 574
35 Ga0466692_011193 3300042591 Bacteria 3367
36 Ga0466715_029960 3300042616 Bacteria 1695
37 Ga0466728_043562 3300042620 Bacteria 9745
38 Ga0466704_571783 3300042643 Bacteria 2361
39 Ga0466709_108523 3300042648 Bacteria 2170
40 Ga0466708_101670 3300042652 Bacteria 2098
41 JGI24698J34947_10014814 3300002449 Bacteria 4246
42 JGI24695J34938_10000168 3300002450 Bacteria 61343
43 JGI24695J34938_10001734 3300002450 Bacteria 18016
44 JGI24695J34938_10008381 3300002450 Bacteria 5903
45 JGI24695J34938_10224068 3300002450 Bacteria 790
46 Ga0072941_1015028 3300005201 Archaea 2059
47 Ga0123357_10748421 3300009784 Bacteria 680
48 Ga0123356_10004055 3300010049 Bacteria 15207
49 Ga0466690_057503 3300042590 Bacteria 2372
50 Ga0466693_419846 3300042592 Bacteria 23203
51 Ga0466712_189335 3300042614 Unclassified 6781
52 Ga0466716_373267 3300042605 Bacteria 3036
53 Ga0466719_261117 3300042606 Bacteria 4060
54 Ga0466704_465208 3300042643 Bacteria 1513
55 Ga0466727_100875 3300042655 Bacteria 5818
56 JGI24698J34947_10058188 3300002449 Unclassified 1915
57 JGI24695J34938_10598912 3300002450 Bacteria 513
58 Ga0123353_10148188 3300010167 Bacteria 3750
59 Ga0466699_205782 3300042597 Bacteria 1322
60 Ga0466712_205302 3300042614 Bacteria 1266
61 Ga0466716_398058 3300042605 Bacteria 3541
62 Ga0466720_042545 3300042607 Bacteria 1428
63 Ga0466720_106127 3300042607 Bacteria 10173
64 Ga0466698_004647 3300042610 Unclassified 1242
65 Ga0466705_011438 3300042612 Bacteria 2103
66 Ga0466705_148159 3300042612 Bacteria 2543
67 Ga0466703_214560 3300042636 Bacteria 2373
68 Ga0466703_360233 3300042636 Bacteria 1144
69 JGI24698J34947_10245022 3300002449 Bacteria 673
70 JGI24695J34938_10008358 3300002450 Bacteria 5917
71 JGI24695J34938_10014164 3300002450 Bacteria 4149
72 JGI24695J34938_10094605 3300002450 Bacteria 1224
73 Ga0123356_10030385 3300010049 Bacteria 5057
74 Ga0123356_10381426 3300010049 Unclassified 1542
75 Ga0123356_10498114 3300010049 Bacteria 1374
76 Ga0264413_158045 3300024493 Bacteria 1342
77 Ga0466694_396886 3300042594 Bacteria 23159
78 Ga0466696_491051 3300042596 Bacteria 7156
79 Ga0466699_300243 3300042597 Unclassified 1209
80 Ga0466705_407396 3300042612 Unclassified 1319
81 Ga0466712_098539 3300042614 Bacteria 7114
82 Ga0466712_240902 3300042614 Bacteria 4168
83 Ga0466718_047660 3300042617 Bacteria 22268
84 Ga0466728_142866 3300042620 Bacteria 8981
85 Ga0466720_138657 3300042607 Bacteria 14833
86 Ga0466705_238508 3300042612 Bacteria 6993
87 Ga0466704_607314 3300042643 Bacteria 1602
88 Ga0466727_258945 3300042655 Bacteria 1206
89 JGI24698J34947_10060807 3300002449 Unclassified 1862
90 JGI24695J34938_10086748 3300002450 Bacteria 1288
91 Ga0072940_1335896 3300005200 Unclassified 3239
92 Ga0072941_1062624 3300005201 Bacteria 3227
93 Ga0456237_0032664 3300041968 Unclassified 696
94 Ga0466690_115070 3300042590 Bacteria 5175
95 Ga0466696_295258 3300042596 Bacteria 3151
96 Ga0466699_101446 3300042597 Bacteria 3293
97 Ga0466699_423799 3300042597 Unclassified 1123
98 Ga0466712_076593 3300042614 Bacteria 1034
99 Ga0466728_190310 3300042620 Bacteria 3070
100 Ga0466732_011886 3300042656 Bacteria 4981
101 Ga0466732_082616 3300042656 Bacteria 2169
102 Ga0466732_144867 3300042656 Bacteria 1289
103 Ga0466716_414955 3300042605 Bacteria 3271
104 Ga0466721_215915 3300042608 Bacteria 2037
105 Ga0466722_117997 3300042609 Bacteria 3799
106 Ga0466704_325624 3300042643 Bacteria 5694
107 Ga0466704_410821 3300042643 Bacteria 2271
108 Ga0466704_472314 3300042643 Bacteria 2711
109 Ga0466708_275061 3300042652 Viruses 3588
110 JGI24698J34947_10088957 3300002449 Unclassified 1423
111 JGI24695J34938_10017661 3300002450 Archaea 3586
112 JGI24695J34938_10072677 3300002450 Bacteria 1434
113 JGI24697J35500_11270589 3300002507 Unclassified 4259
114 Ga0466692_072584 3300042591 Bacteria 7661
115 Ga0466691_192344 3300042593 Bacteria 1648
116 Ga0466694_392428 3300042594 Bacteria 1366
117 Ga0466696_160177 3300042596 Bacteria 23979
118 Ga0466715_150509 3300042616 Bacteria 7398
119 Ga0466726_253298 3300042619 Bacteria 1075
120 Ga0466716_243397 3300042605 Bacteria 1289
121 Ga0466719_215688 3300042606 Bacteria 2075
122 Ga0466719_231890 3300042606 Bacteria 2509
123 Ga0466720_100616 3300042607 Unclassified 5027
124 Ga0466704_404254 3300042643 Bacteria 1256
125 JGI24698J34947_10009833 3300002449 Unclassified 5245
126 JGI24699J35502_11103059 3300002509 Unclassified 2422
127 Ga0072941_1015027 3300005201 Unclassified 1781
128 Ga0074263_115488 3300005485 Unclassified 888
129 Ga0123356_10266199 3300010049 Bacteria 1801

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_011193 Ga0466692_011193_303_638 111
2 3300002449 JGI24698J34947_10245022 JGI24698J34947_102450222 114
3 3300024493 Ga0264413_158045 Ga0264413_1580453 114
4 3300042591 Ga0466692_155266 Ga0466692_155266_1030_1374 114
5 3300002450 JGI24695J34938_10072677 JGI24695J34938_100726773 115
6 3300002450 JGI24695J34938_10086748 JGI24695J34938_100867481 115
7 3300002450 JGI24695J34938_10094605 JGI24695J34938_100946051 115
8 3300002509 JGI24699J35502_11103059 JGI24699J35502_111030593 115
9 3300005201 Ga0072941_1015028 Ga0072941_10150284 115
10 3300005485 Ga0074263_115488 Ga0074263_1154882 115
11 3300042597 Ga0466699_205782 Ga0466699_205782_352_699 115
12 3300042597 Ga0466699_423799 Ga0466699_423799_199_546 115
13 3300002449 JGI24698J34947_10060807 JGI24698J34947_100608071 116
14 3300002450 JGI24695J34938_10380474 JGI24695J34938_103804741 116
15 3300002507 JGI24697J35500_11270589 JGI24697J35500_112705892 116
16 3300042594 Ga0466694_396886 Ga0466694_396886_243_593 116
17 3300042597 Ga0466699_300243 Ga0466699_300243_361_711 116
18 3300042597 Ga0466699_378943 Ga0466699_378943_398_748 116
19 3300042605 Ga0466716_414955 Ga0466716_414955_966_1316 116
20 3300042617 Ga0466718_165570 Ga0466718_165570_1215_1565 116
21 3300042618 Ga0466723_116834 Ga0466723_116834_241_591 116
22 3300042620 Ga0466728_349741 Ga0466728_349741_946_1296 116
23 3300042652 Ga0466708_054758 Ga0466708_054758_1744_2094 116
24 3300002449 JGI24698J34947_10041510 JGI24698J34947_100415102 117
25 3300002450 JGI24695J34938_10464237 JGI24695J34938_104642371 117
26 3300005200 Ga0072940_1335896 Ga0072940_13358964 117
27 3300010049 Ga0123356_10004055 Ga0123356_100040556 117
28 3300038395 Ga0415639_103111 Ga0415639_103111_220_573 117
29 3300041968 Ga0456237_0032664 Ga0456237_0032664_180_533 117
30 3300042591 Ga0466692_040510 Ga0466692_040510_540_893 117
31 3300042591 Ga0466692_163754 Ga0466692_163754_6730_7083 117
32 3300042593 Ga0466691_192344 Ga0466691_192344_711_1064 117
33 3300042596 Ga0466696_012632 Ga0466696_012632_1537_1890 117
34 3300042596 Ga0466696_138856 Ga0466696_138856_160_513 117
35 3300042596 Ga0466696_295258 Ga0466696_295258_956_1309 117
36 3300042596 Ga0466696_491051 Ga0466696_491051_3691_4044 117
37 3300042605 Ga0466716_243397 Ga0466716_243397_382_735 117
38 3300042606 Ga0466719_215688 Ga0466719_215688_412_765 117
39 3300042606 Ga0466719_231890 Ga0466719_231890_1794_2147 117
40 3300042606 Ga0466719_261117 Ga0466719_261117_1677_2030 117
41 3300042607 Ga0466720_100616 Ga0466720_100616_3570_3923 117
42 3300042607 Ga0466720_106127 Ga0466720_106127_8005_8358 117
43 3300042607 Ga0466720_138657 Ga0466720_138657_9883_10236 117
44 3300042609 Ga0466722_058656 Ga0466722_058656_870_1223 117
45 3300042609 Ga0466722_117997 Ga0466722_117997_2333_2686 117
46 3300042609 Ga0466722_156425 Ga0466722_156425_5008_5361 117
47 3300042612 Ga0466705_011438 Ga0466705_011438_1502_1855 117
48 3300042612 Ga0466705_148159 Ga0466705_148159_1028_1381 117
49 3300042612 Ga0466705_407396 Ga0466705_407396_426_779 117
50 3300042614 Ga0466712_076593 Ga0466712_076593_398_751 117
51 3300042614 Ga0466712_098539 Ga0466712_098539_4621_4974 117
52 3300042614 Ga0466712_189335 Ga0466712_189335_3353_3706 117
53 3300042616 Ga0466715_150509 Ga0466715_150509_934_1287 117
54 3300042617 Ga0466718_047660 Ga0466718_047660_762_1115 117
55 3300042617 Ga0466718_075735 Ga0466718_075735_2047_2400 117
56 3300042617 Ga0466718_115544 Ga0466718_115544_4526_4879 117
57 3300042619 Ga0466726_253298 Ga0466726_253298_285_638 117
58 3300042620 Ga0466728_142866 Ga0466728_142866_7484_7837 117
59 3300042620 Ga0466728_190310 Ga0466728_190310_1117_1470 117
60 3300042636 Ga0466703_214560 Ga0466703_214560_219_572 117
61 3300042636 Ga0466703_360233 Ga0466703_360233_427_780 117
62 3300042643 Ga0466704_325624 Ga0466704_325624_4820_5173 117
63 3300042643 Ga0466704_363625 Ga0466704_363625_969_1322 117
64 3300042643 Ga0466704_404254 Ga0466704_404254_730_1083 117
65 3300042643 Ga0466704_410821 Ga0466704_410821_253_606 117
66 3300042643 Ga0466704_465208 Ga0466704_465208_891_1244 117
67 3300042643 Ga0466704_472314 Ga0466704_472314_1225_1578 117
68 3300042643 Ga0466704_571783 Ga0466704_571783_956_1309 117
69 3300042643 Ga0466704_607314 Ga0466704_607314_585_938 117
70 3300042652 Ga0466708_275061 Ga0466708_275061_416_769 117
71 3300042655 Ga0466727_100875 Ga0466727_100875_1286_1639 117
72 3300042655 Ga0466727_258945 Ga0466727_258945_229_582 117
73 iso_pr_bacteria 2781125635 2781277623 117
74 iso_pr_bacteria 2781125645 2781298164 117
75 3300002449 JGI24698J34947_10009833 JGI24698J34947_100098338 118
76 3300002449 JGI24698J34947_10014814 JGI24698J34947_100148145 118
77 3300002450 JGI24695J34938_10000126 JGI24695J34938_1000012625 118
78 3300002450 JGI24695J34938_10001734 JGI24695J34938_1000173415 118
79 3300002450 JGI24695J34938_10002907 JGI24695J34938_100029076 118
80 3300002450 JGI24695J34938_10008358 JGI24695J34938_100083581 118
81 3300002450 JGI24695J34938_10008381 JGI24695J34938_100083813 118
82 3300002450 JGI24695J34938_10012116 JGI24695J34938_100121163 118
83 3300002450 JGI24695J34938_10017661 JGI24695J34938_100176613 118
84 3300002450 JGI24695J34938_10224068 JGI24695J34938_102240682 118
85 3300002450 JGI24695J34938_10598912 JGI24695J34938_105989121 118
86 3300005201 Ga0072941_1015027 Ga0072941_10150273 118
87 3300005201 Ga0072941_1062624 Ga0072941_10626245 118
88 3300010049 Ga0123356_10030385 Ga0123356_100303852 118
89 3300010049 Ga0123356_10266199 Ga0123356_102661992 118
90 3300010049 Ga0123356_10381426 Ga0123356_103814263 118
91 3300010049 Ga0123356_10498114 Ga0123356_104981142 118
92 3300010049 Ga0123356_10719585 Ga0123356_107195852 118
93 3300010167 Ga0123353_10148188 Ga0123353_101481882 118
94 3300038395 Ga0415639_085602 Ga0415639_085602_168_524 118
95 3300042591 Ga0466692_072584 Ga0466692_072584_1358_1714 118
96 3300042594 Ga0466694_392428 Ga0466694_392428_766_1122 118
97 3300042597 Ga0466699_101446 Ga0466699_101446_64_420 118
98 3300042614 Ga0466712_192655 Ga0466712_192655_1118_1474 118
99 3300042617 Ga0466718_095910 Ga0466718_095910_5139_5495 118
100 3300042620 Ga0466728_043562 Ga0466728_043562_9007_9363 118
101 3300042656 Ga0466732_144867 Ga0466732_144867_246_602 118
102 3300002449 JGI24698J34947_10059175 JGI24698J34947_100591752 119
103 3300005201 Ga0072941_1053635 Ga0072941_10536352 119
104 3300042607 Ga0466720_042545 Ga0466720_042545_759_1118 119
105 3300042612 Ga0466705_188785 Ga0466705_188785_30_389 119
106 3300042612 Ga0466705_238508 Ga0466705_238508_4672_5031 119
107 3300042656 Ga0466732_082616 Ga0466732_082616_621_980 119
108 3300042590 Ga0466690_115070 Ga0466690_115070_2080_2442 120
109 3300042592 Ga0466693_419846 Ga0466693_419846_863_1225 120
110 3300042596 Ga0466696_160177 Ga0466696_160177_20701_21063 120
111 3300042605 Ga0466716_373267 Ga0466716_373267_1359_1721 120
112 3300042609 Ga0466722_171142 Ga0466722_171142_754_1116 120
113 3300042614 Ga0466712_240902 Ga0466712_240902_148_510 120
114 3300042616 Ga0466715_029960 Ga0466715_029960_210_572 120
115 3300042648 Ga0466709_081313 Ga0466709_081313_890_1252 120
116 3300042648 Ga0466709_108523 Ga0466709_108523_207_569 120
117 3300042652 Ga0466708_101670 Ga0466708_101670_211_573 120
118 3300042656 Ga0466732_011886 Ga0466732_011886_2965_3327 120
119 iso_pr_bacteria 2781125650 2781308090 120
120 3300002449 JGI24698J34947_10058188 JGI24698J34947_100581884 121
121 3300002450 JGI24695J34938_10000168 JGI24695J34938_1000016844 121
122 3300002450 JGI24695J34938_10229119 JGI24695J34938_102291192 121
123 3300002449 JGI24698J34947_10088957 JGI24698J34947_100889573 122
124 3300002450 JGI24695J34938_10014164 JGI24695J34938_100141643 122
125 3300042590 Ga0466690_057503 Ga0466690_057503_304_675 123
126 3300042608 Ga0466721_215915 Ga0466721_215915_1564_1935 123
127 3300042614 Ga0466712_223254 Ga0466712_223254_370_741 123
128 iso_pr_bacteria 2781125694 2781437331 123
129 3300009784 Ga0123357_10748421 Ga0123357_107484212 124
130 3300042605 Ga0466716_398058 Ga0466716_398058_608_982 124
131 3300042614 Ga0466712_205302 Ga0466712_205302_826_1200 124
132 3300042609 Ga0466722_157054 Ga0466722_157054_2328_2705 125
133 3300042610 Ga0466698_004647 Ga0466698_004647_323_730 135

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01381 HTH_3 Helix-turn-helix 11 62 0.96
PF12844 HTH_19 Helix-turn-helix domain 11 62 0.92

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
1adr-assembly1.cif.gz_A DETERMINATION OF THE NUCLEAR MAGNETIC RESONANCE STRUCTURE OF THE DNA-BINDING DOMAIN OF THE P22 C2 REPRESSOR (1-76) IN SOLUTION AND COMPARISON WITH THE DNA-BINDING DOMAIN OF THE 434 REPRESSOR 0.944 7 65
3zkc-assembly1.cif.gz_A Crystal structure of the master regulator for biofilm formation SinR in complex with DNA. 0.938 8 65
1y7y-assembly1.cif.gz_B High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila 0.937 6 66
1y7y-assembly1.cif.gz_A High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila 0.935 7 66
7t8i-assembly1.cif.gz_B Crystal structure of the ImmR transcriptional regulator DNA-binding domain of Bacillus subtilis 0.933 7 66
IDDescriptionScoreStartEndSuperfamily
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9436 7 65 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9377 8 65 1.10.260.40
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9374 6 68 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9368 6 66 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9355 7 66 1.10.260.40
IDDescriptionScoreStartEndGO Terms
AF-A0A3E1RH47-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9691 1 67 GO:0005829
GO:0003677
GO:0003700
AF-A0A7X7AKY5-F1-model_v4 Uncharacterized/unreviewed 0.9687 3 67

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.56 0.63 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.