Protein Family IF05208
Metagenome
Isolate
133
Members
43
Samples
129
Scaffolds
117.95
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_295258|Ga0466696_295258_956_1309
- Length
- 117 aa
- Sequence
- MEMMKIFVYNMKKYRKKRQLSQMKLAEMINTSTSYIGEIEINSKVPSMEMVEKISKALSVEPFRLFVDNRNDAAVSTDISYLSALSPPERQDLTERLVALIANNVEQLLQPENSPRP
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.3%
Kalotermitidae
31.7%
Unclassified
9.8%
Rhinotermitidae
7.3%
Termopsidae
4.9%
Taxonomy
Archaea
2
Bacteria
107
Eukaryota
0
Viruses
1
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 17 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 21 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_155266 | 3300042591 | Bacteria | 7776 |
| 2 | Ga0466692_163754 | 3300042591 | Bacteria | 17044 |
| 3 | Ga0466696_138856 | 3300042596 | Unclassified | 1669 |
| 4 | Ga0466718_075735 | 3300042617 | Bacteria | 2478 |
| 5 | Ga0466718_115544 | 3300042617 | Bacteria | 8643 |
| 6 | Ga0466718_165570 | 3300042617 | Bacteria | 1955 |
| 7 | Ga0466723_116834 | 3300042618 | Bacteria | 3405 |
| 8 | Ga0466722_156425 | 3300042609 | Bacteria | 5586 |
| 9 | Ga0466722_157054 | 3300042609 | Bacteria | 6132 |
| 10 | Ga0466722_171142 | 3300042609 | Bacteria | 1359 |
| 11 | Ga0466708_054758 | 3300042652 | Bacteria | 4428 |
| 12 | JGI24698J34947_10041510 | 3300002449 | Bacteria | 2369 |
| 13 | JGI24698J34947_10059175 | 3300002449 | Bacteria | 1895 |
| 14 | JGI24695J34938_10012116 | 3300002450 | Unclassified | 4593 |
| 15 | JGI24695J34938_10229119 | 3300002450 | Unclassified | 782 |
| 16 | Ga0072941_1053635 | 3300005201 | Bacteria | 5168 |
| 17 | Ga0123356_10719585 | 3300010049 | Bacteria | 1168 |
| 18 | Ga0415639_085602 | 3300038395 | Bacteria | 1291 |
| 19 | Ga0415639_103111 | 3300038395 | Unclassified | 2350 |
| 20 | Ga0466692_040510 | 3300042591 | Bacteria | 3326 |
| 21 | Ga0466696_012632 | 3300042596 | Bacteria | 8951 |
| 22 | Ga0466699_378943 | 3300042597 | Unclassified | 1112 |
| 23 | Ga0466712_192655 | 3300042614 | Unclassified | 1637 |
| 24 | Ga0466712_223254 | 3300042614 | Bacteria | 1219 |
| 25 | Ga0466718_095910 | 3300042617 | Bacteria | 5701 |
| 26 | Ga0466728_349741 | 3300042620 | Bacteria | 1581 |
| 27 | Ga0466722_058656 | 3300042609 | Bacteria | 1481 |
| 28 | Ga0466705_188785 | 3300042612 | Bacteria | 2250 |
| 29 | Ga0466704_363625 | 3300042643 | Bacteria | 4299 |
| 30 | Ga0466709_081313 | 3300042648 | Bacteria | 4067 |
| 31 | JGI24695J34938_10000126 | 3300002450 | Bacteria | 68489 |
| 32 | JGI24695J34938_10002907 | 3300002450 | Bacteria | 12446 |
| 33 | JGI24695J34938_10380474 | 3300002450 | Bacteria | 626 |
| 34 | JGI24695J34938_10464237 | 3300002450 | Bacteria | 574 |
| 35 | Ga0466692_011193 | 3300042591 | Bacteria | 3367 |
| 36 | Ga0466715_029960 | 3300042616 | Bacteria | 1695 |
| 37 | Ga0466728_043562 | 3300042620 | Bacteria | 9745 |
| 38 | Ga0466704_571783 | 3300042643 | Bacteria | 2361 |
| 39 | Ga0466709_108523 | 3300042648 | Bacteria | 2170 |
| 40 | Ga0466708_101670 | 3300042652 | Bacteria | 2098 |
| 41 | JGI24698J34947_10014814 | 3300002449 | Bacteria | 4246 |
| 42 | JGI24695J34938_10000168 | 3300002450 | Bacteria | 61343 |
| 43 | JGI24695J34938_10001734 | 3300002450 | Bacteria | 18016 |
| 44 | JGI24695J34938_10008381 | 3300002450 | Bacteria | 5903 |
| 45 | JGI24695J34938_10224068 | 3300002450 | Bacteria | 790 |
| 46 | Ga0072941_1015028 | 3300005201 | Archaea | 2059 |
| 47 | Ga0123357_10748421 | 3300009784 | Bacteria | 680 |
| 48 | Ga0123356_10004055 | 3300010049 | Bacteria | 15207 |
| 49 | Ga0466690_057503 | 3300042590 | Bacteria | 2372 |
| 50 | Ga0466693_419846 | 3300042592 | Bacteria | 23203 |
| 51 | Ga0466712_189335 | 3300042614 | Unclassified | 6781 |
| 52 | Ga0466716_373267 | 3300042605 | Bacteria | 3036 |
| 53 | Ga0466719_261117 | 3300042606 | Bacteria | 4060 |
| 54 | Ga0466704_465208 | 3300042643 | Bacteria | 1513 |
| 55 | Ga0466727_100875 | 3300042655 | Bacteria | 5818 |
| 56 | JGI24698J34947_10058188 | 3300002449 | Unclassified | 1915 |
| 57 | JGI24695J34938_10598912 | 3300002450 | Bacteria | 513 |
| 58 | Ga0123353_10148188 | 3300010167 | Bacteria | 3750 |
| 59 | Ga0466699_205782 | 3300042597 | Bacteria | 1322 |
| 60 | Ga0466712_205302 | 3300042614 | Bacteria | 1266 |
| 61 | Ga0466716_398058 | 3300042605 | Bacteria | 3541 |
| 62 | Ga0466720_042545 | 3300042607 | Bacteria | 1428 |
| 63 | Ga0466720_106127 | 3300042607 | Bacteria | 10173 |
| 64 | Ga0466698_004647 | 3300042610 | Unclassified | 1242 |
| 65 | Ga0466705_011438 | 3300042612 | Bacteria | 2103 |
| 66 | Ga0466705_148159 | 3300042612 | Bacteria | 2543 |
| 67 | Ga0466703_214560 | 3300042636 | Bacteria | 2373 |
| 68 | Ga0466703_360233 | 3300042636 | Bacteria | 1144 |
| 69 | JGI24698J34947_10245022 | 3300002449 | Bacteria | 673 |
| 70 | JGI24695J34938_10008358 | 3300002450 | Bacteria | 5917 |
| 71 | JGI24695J34938_10014164 | 3300002450 | Bacteria | 4149 |
| 72 | JGI24695J34938_10094605 | 3300002450 | Bacteria | 1224 |
| 73 | Ga0123356_10030385 | 3300010049 | Bacteria | 5057 |
| 74 | Ga0123356_10381426 | 3300010049 | Unclassified | 1542 |
| 75 | Ga0123356_10498114 | 3300010049 | Bacteria | 1374 |
| 76 | Ga0264413_158045 | 3300024493 | Bacteria | 1342 |
| 77 | Ga0466694_396886 | 3300042594 | Bacteria | 23159 |
| 78 | Ga0466696_491051 | 3300042596 | Bacteria | 7156 |
| 79 | Ga0466699_300243 | 3300042597 | Unclassified | 1209 |
| 80 | Ga0466705_407396 | 3300042612 | Unclassified | 1319 |
| 81 | Ga0466712_098539 | 3300042614 | Bacteria | 7114 |
| 82 | Ga0466712_240902 | 3300042614 | Bacteria | 4168 |
| 83 | Ga0466718_047660 | 3300042617 | Bacteria | 22268 |
| 84 | Ga0466728_142866 | 3300042620 | Bacteria | 8981 |
| 85 | Ga0466720_138657 | 3300042607 | Bacteria | 14833 |
| 86 | Ga0466705_238508 | 3300042612 | Bacteria | 6993 |
| 87 | Ga0466704_607314 | 3300042643 | Bacteria | 1602 |
| 88 | Ga0466727_258945 | 3300042655 | Bacteria | 1206 |
| 89 | JGI24698J34947_10060807 | 3300002449 | Unclassified | 1862 |
| 90 | JGI24695J34938_10086748 | 3300002450 | Bacteria | 1288 |
| 91 | Ga0072940_1335896 | 3300005200 | Unclassified | 3239 |
| 92 | Ga0072941_1062624 | 3300005201 | Bacteria | 3227 |
| 93 | Ga0456237_0032664 | 3300041968 | Unclassified | 696 |
| 94 | Ga0466690_115070 | 3300042590 | Bacteria | 5175 |
| 95 | Ga0466696_295258 | 3300042596 | Bacteria | 3151 |
| 96 | Ga0466699_101446 | 3300042597 | Bacteria | 3293 |
| 97 | Ga0466699_423799 | 3300042597 | Unclassified | 1123 |
| 98 | Ga0466712_076593 | 3300042614 | Bacteria | 1034 |
| 99 | Ga0466728_190310 | 3300042620 | Bacteria | 3070 |
| 100 | Ga0466732_011886 | 3300042656 | Bacteria | 4981 |
| 101 | Ga0466732_082616 | 3300042656 | Bacteria | 2169 |
| 102 | Ga0466732_144867 | 3300042656 | Bacteria | 1289 |
| 103 | Ga0466716_414955 | 3300042605 | Bacteria | 3271 |
| 104 | Ga0466721_215915 | 3300042608 | Bacteria | 2037 |
| 105 | Ga0466722_117997 | 3300042609 | Bacteria | 3799 |
| 106 | Ga0466704_325624 | 3300042643 | Bacteria | 5694 |
| 107 | Ga0466704_410821 | 3300042643 | Bacteria | 2271 |
| 108 | Ga0466704_472314 | 3300042643 | Bacteria | 2711 |
| 109 | Ga0466708_275061 | 3300042652 | Viruses | 3588 |
| 110 | JGI24698J34947_10088957 | 3300002449 | Unclassified | 1423 |
| 111 | JGI24695J34938_10017661 | 3300002450 | Archaea | 3586 |
| 112 | JGI24695J34938_10072677 | 3300002450 | Bacteria | 1434 |
| 113 | JGI24697J35500_11270589 | 3300002507 | Unclassified | 4259 |
| 114 | Ga0466692_072584 | 3300042591 | Bacteria | 7661 |
| 115 | Ga0466691_192344 | 3300042593 | Bacteria | 1648 |
| 116 | Ga0466694_392428 | 3300042594 | Bacteria | 1366 |
| 117 | Ga0466696_160177 | 3300042596 | Bacteria | 23979 |
| 118 | Ga0466715_150509 | 3300042616 | Bacteria | 7398 |
| 119 | Ga0466726_253298 | 3300042619 | Bacteria | 1075 |
| 120 | Ga0466716_243397 | 3300042605 | Bacteria | 1289 |
| 121 | Ga0466719_215688 | 3300042606 | Bacteria | 2075 |
| 122 | Ga0466719_231890 | 3300042606 | Bacteria | 2509 |
| 123 | Ga0466720_100616 | 3300042607 | Unclassified | 5027 |
| 124 | Ga0466704_404254 | 3300042643 | Bacteria | 1256 |
| 125 | JGI24698J34947_10009833 | 3300002449 | Unclassified | 5245 |
| 126 | JGI24699J35502_11103059 | 3300002509 | Unclassified | 2422 |
| 127 | Ga0072941_1015027 | 3300005201 | Unclassified | 1781 |
| 128 | Ga0074263_115488 | 3300005485 | Unclassified | 888 |
| 129 | Ga0123356_10266199 | 3300010049 | Bacteria | 1801 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042591 | Ga0466692_011193 | Ga0466692_011193_303_638 | 111 |
| 2 | 3300002449 | JGI24698J34947_10245022 | JGI24698J34947_102450222 | 114 |
| 3 | 3300024493 | Ga0264413_158045 | Ga0264413_1580453 | 114 |
| 4 | 3300042591 | Ga0466692_155266 | Ga0466692_155266_1030_1374 | 114 |
| 5 | 3300002450 | JGI24695J34938_10072677 | JGI24695J34938_100726773 | 115 |
| 6 | 3300002450 | JGI24695J34938_10086748 | JGI24695J34938_100867481 | 115 |
| 7 | 3300002450 | JGI24695J34938_10094605 | JGI24695J34938_100946051 | 115 |
| 8 | 3300002509 | JGI24699J35502_11103059 | JGI24699J35502_111030593 | 115 |
| 9 | 3300005201 | Ga0072941_1015028 | Ga0072941_10150284 | 115 |
| 10 | 3300005485 | Ga0074263_115488 | Ga0074263_1154882 | 115 |
| 11 | 3300042597 | Ga0466699_205782 | Ga0466699_205782_352_699 | 115 |
| 12 | 3300042597 | Ga0466699_423799 | Ga0466699_423799_199_546 | 115 |
| 13 | 3300002449 | JGI24698J34947_10060807 | JGI24698J34947_100608071 | 116 |
| 14 | 3300002450 | JGI24695J34938_10380474 | JGI24695J34938_103804741 | 116 |
| 15 | 3300002507 | JGI24697J35500_11270589 | JGI24697J35500_112705892 | 116 |
| 16 | 3300042594 | Ga0466694_396886 | Ga0466694_396886_243_593 | 116 |
| 17 | 3300042597 | Ga0466699_300243 | Ga0466699_300243_361_711 | 116 |
| 18 | 3300042597 | Ga0466699_378943 | Ga0466699_378943_398_748 | 116 |
| 19 | 3300042605 | Ga0466716_414955 | Ga0466716_414955_966_1316 | 116 |
| 20 | 3300042617 | Ga0466718_165570 | Ga0466718_165570_1215_1565 | 116 |
| 21 | 3300042618 | Ga0466723_116834 | Ga0466723_116834_241_591 | 116 |
| 22 | 3300042620 | Ga0466728_349741 | Ga0466728_349741_946_1296 | 116 |
| 23 | 3300042652 | Ga0466708_054758 | Ga0466708_054758_1744_2094 | 116 |
| 24 | 3300002449 | JGI24698J34947_10041510 | JGI24698J34947_100415102 | 117 |
| 25 | 3300002450 | JGI24695J34938_10464237 | JGI24695J34938_104642371 | 117 |
| 26 | 3300005200 | Ga0072940_1335896 | Ga0072940_13358964 | 117 |
| 27 | 3300010049 | Ga0123356_10004055 | Ga0123356_100040556 | 117 |
| 28 | 3300038395 | Ga0415639_103111 | Ga0415639_103111_220_573 | 117 |
| 29 | 3300041968 | Ga0456237_0032664 | Ga0456237_0032664_180_533 | 117 |
| 30 | 3300042591 | Ga0466692_040510 | Ga0466692_040510_540_893 | 117 |
| 31 | 3300042591 | Ga0466692_163754 | Ga0466692_163754_6730_7083 | 117 |
| 32 | 3300042593 | Ga0466691_192344 | Ga0466691_192344_711_1064 | 117 |
| 33 | 3300042596 | Ga0466696_012632 | Ga0466696_012632_1537_1890 | 117 |
| 34 | 3300042596 | Ga0466696_138856 | Ga0466696_138856_160_513 | 117 |
| 35 | 3300042596 | Ga0466696_295258 | Ga0466696_295258_956_1309 | 117 |
| 36 | 3300042596 | Ga0466696_491051 | Ga0466696_491051_3691_4044 | 117 |
| 37 | 3300042605 | Ga0466716_243397 | Ga0466716_243397_382_735 | 117 |
| 38 | 3300042606 | Ga0466719_215688 | Ga0466719_215688_412_765 | 117 |
| 39 | 3300042606 | Ga0466719_231890 | Ga0466719_231890_1794_2147 | 117 |
| 40 | 3300042606 | Ga0466719_261117 | Ga0466719_261117_1677_2030 | 117 |
| 41 | 3300042607 | Ga0466720_100616 | Ga0466720_100616_3570_3923 | 117 |
| 42 | 3300042607 | Ga0466720_106127 | Ga0466720_106127_8005_8358 | 117 |
| 43 | 3300042607 | Ga0466720_138657 | Ga0466720_138657_9883_10236 | 117 |
| 44 | 3300042609 | Ga0466722_058656 | Ga0466722_058656_870_1223 | 117 |
| 45 | 3300042609 | Ga0466722_117997 | Ga0466722_117997_2333_2686 | 117 |
| 46 | 3300042609 | Ga0466722_156425 | Ga0466722_156425_5008_5361 | 117 |
| 47 | 3300042612 | Ga0466705_011438 | Ga0466705_011438_1502_1855 | 117 |
| 48 | 3300042612 | Ga0466705_148159 | Ga0466705_148159_1028_1381 | 117 |
| 49 | 3300042612 | Ga0466705_407396 | Ga0466705_407396_426_779 | 117 |
| 50 | 3300042614 | Ga0466712_076593 | Ga0466712_076593_398_751 | 117 |
| 51 | 3300042614 | Ga0466712_098539 | Ga0466712_098539_4621_4974 | 117 |
| 52 | 3300042614 | Ga0466712_189335 | Ga0466712_189335_3353_3706 | 117 |
| 53 | 3300042616 | Ga0466715_150509 | Ga0466715_150509_934_1287 | 117 |
| 54 | 3300042617 | Ga0466718_047660 | Ga0466718_047660_762_1115 | 117 |
| 55 | 3300042617 | Ga0466718_075735 | Ga0466718_075735_2047_2400 | 117 |
| 56 | 3300042617 | Ga0466718_115544 | Ga0466718_115544_4526_4879 | 117 |
| 57 | 3300042619 | Ga0466726_253298 | Ga0466726_253298_285_638 | 117 |
| 58 | 3300042620 | Ga0466728_142866 | Ga0466728_142866_7484_7837 | 117 |
| 59 | 3300042620 | Ga0466728_190310 | Ga0466728_190310_1117_1470 | 117 |
| 60 | 3300042636 | Ga0466703_214560 | Ga0466703_214560_219_572 | 117 |
| 61 | 3300042636 | Ga0466703_360233 | Ga0466703_360233_427_780 | 117 |
| 62 | 3300042643 | Ga0466704_325624 | Ga0466704_325624_4820_5173 | 117 |
| 63 | 3300042643 | Ga0466704_363625 | Ga0466704_363625_969_1322 | 117 |
| 64 | 3300042643 | Ga0466704_404254 | Ga0466704_404254_730_1083 | 117 |
| 65 | 3300042643 | Ga0466704_410821 | Ga0466704_410821_253_606 | 117 |
| 66 | 3300042643 | Ga0466704_465208 | Ga0466704_465208_891_1244 | 117 |
| 67 | 3300042643 | Ga0466704_472314 | Ga0466704_472314_1225_1578 | 117 |
| 68 | 3300042643 | Ga0466704_571783 | Ga0466704_571783_956_1309 | 117 |
| 69 | 3300042643 | Ga0466704_607314 | Ga0466704_607314_585_938 | 117 |
| 70 | 3300042652 | Ga0466708_275061 | Ga0466708_275061_416_769 | 117 |
| 71 | 3300042655 | Ga0466727_100875 | Ga0466727_100875_1286_1639 | 117 |
| 72 | 3300042655 | Ga0466727_258945 | Ga0466727_258945_229_582 | 117 |
| 73 | iso_pr_bacteria | 2781125635 | 2781277623 | 117 |
| 74 | iso_pr_bacteria | 2781125645 | 2781298164 | 117 |
| 75 | 3300002449 | JGI24698J34947_10009833 | JGI24698J34947_100098338 | 118 |
| 76 | 3300002449 | JGI24698J34947_10014814 | JGI24698J34947_100148145 | 118 |
| 77 | 3300002450 | JGI24695J34938_10000126 | JGI24695J34938_1000012625 | 118 |
| 78 | 3300002450 | JGI24695J34938_10001734 | JGI24695J34938_1000173415 | 118 |
| 79 | 3300002450 | JGI24695J34938_10002907 | JGI24695J34938_100029076 | 118 |
| 80 | 3300002450 | JGI24695J34938_10008358 | JGI24695J34938_100083581 | 118 |
| 81 | 3300002450 | JGI24695J34938_10008381 | JGI24695J34938_100083813 | 118 |
| 82 | 3300002450 | JGI24695J34938_10012116 | JGI24695J34938_100121163 | 118 |
| 83 | 3300002450 | JGI24695J34938_10017661 | JGI24695J34938_100176613 | 118 |
| 84 | 3300002450 | JGI24695J34938_10224068 | JGI24695J34938_102240682 | 118 |
| 85 | 3300002450 | JGI24695J34938_10598912 | JGI24695J34938_105989121 | 118 |
| 86 | 3300005201 | Ga0072941_1015027 | Ga0072941_10150273 | 118 |
| 87 | 3300005201 | Ga0072941_1062624 | Ga0072941_10626245 | 118 |
| 88 | 3300010049 | Ga0123356_10030385 | Ga0123356_100303852 | 118 |
| 89 | 3300010049 | Ga0123356_10266199 | Ga0123356_102661992 | 118 |
| 90 | 3300010049 | Ga0123356_10381426 | Ga0123356_103814263 | 118 |
| 91 | 3300010049 | Ga0123356_10498114 | Ga0123356_104981142 | 118 |
| 92 | 3300010049 | Ga0123356_10719585 | Ga0123356_107195852 | 118 |
| 93 | 3300010167 | Ga0123353_10148188 | Ga0123353_101481882 | 118 |
| 94 | 3300038395 | Ga0415639_085602 | Ga0415639_085602_168_524 | 118 |
| 95 | 3300042591 | Ga0466692_072584 | Ga0466692_072584_1358_1714 | 118 |
| 96 | 3300042594 | Ga0466694_392428 | Ga0466694_392428_766_1122 | 118 |
| 97 | 3300042597 | Ga0466699_101446 | Ga0466699_101446_64_420 | 118 |
| 98 | 3300042614 | Ga0466712_192655 | Ga0466712_192655_1118_1474 | 118 |
| 99 | 3300042617 | Ga0466718_095910 | Ga0466718_095910_5139_5495 | 118 |
| 100 | 3300042620 | Ga0466728_043562 | Ga0466728_043562_9007_9363 | 118 |
| 101 | 3300042656 | Ga0466732_144867 | Ga0466732_144867_246_602 | 118 |
| 102 | 3300002449 | JGI24698J34947_10059175 | JGI24698J34947_100591752 | 119 |
| 103 | 3300005201 | Ga0072941_1053635 | Ga0072941_10536352 | 119 |
| 104 | 3300042607 | Ga0466720_042545 | Ga0466720_042545_759_1118 | 119 |
| 105 | 3300042612 | Ga0466705_188785 | Ga0466705_188785_30_389 | 119 |
| 106 | 3300042612 | Ga0466705_238508 | Ga0466705_238508_4672_5031 | 119 |
| 107 | 3300042656 | Ga0466732_082616 | Ga0466732_082616_621_980 | 119 |
| 108 | 3300042590 | Ga0466690_115070 | Ga0466690_115070_2080_2442 | 120 |
| 109 | 3300042592 | Ga0466693_419846 | Ga0466693_419846_863_1225 | 120 |
| 110 | 3300042596 | Ga0466696_160177 | Ga0466696_160177_20701_21063 | 120 |
| 111 | 3300042605 | Ga0466716_373267 | Ga0466716_373267_1359_1721 | 120 |
| 112 | 3300042609 | Ga0466722_171142 | Ga0466722_171142_754_1116 | 120 |
| 113 | 3300042614 | Ga0466712_240902 | Ga0466712_240902_148_510 | 120 |
| 114 | 3300042616 | Ga0466715_029960 | Ga0466715_029960_210_572 | 120 |
| 115 | 3300042648 | Ga0466709_081313 | Ga0466709_081313_890_1252 | 120 |
| 116 | 3300042648 | Ga0466709_108523 | Ga0466709_108523_207_569 | 120 |
| 117 | 3300042652 | Ga0466708_101670 | Ga0466708_101670_211_573 | 120 |
| 118 | 3300042656 | Ga0466732_011886 | Ga0466732_011886_2965_3327 | 120 |
| 119 | iso_pr_bacteria | 2781125650 | 2781308090 | 120 |
| 120 | 3300002449 | JGI24698J34947_10058188 | JGI24698J34947_100581884 | 121 |
| 121 | 3300002450 | JGI24695J34938_10000168 | JGI24695J34938_1000016844 | 121 |
| 122 | 3300002450 | JGI24695J34938_10229119 | JGI24695J34938_102291192 | 121 |
| 123 | 3300002449 | JGI24698J34947_10088957 | JGI24698J34947_100889573 | 122 |
| 124 | 3300002450 | JGI24695J34938_10014164 | JGI24695J34938_100141643 | 122 |
| 125 | 3300042590 | Ga0466690_057503 | Ga0466690_057503_304_675 | 123 |
| 126 | 3300042608 | Ga0466721_215915 | Ga0466721_215915_1564_1935 | 123 |
| 127 | 3300042614 | Ga0466712_223254 | Ga0466712_223254_370_741 | 123 |
| 128 | iso_pr_bacteria | 2781125694 | 2781437331 | 123 |
| 129 | 3300009784 | Ga0123357_10748421 | Ga0123357_107484212 | 124 |
| 130 | 3300042605 | Ga0466716_398058 | Ga0466716_398058_608_982 | 124 |
| 131 | 3300042614 | Ga0466712_205302 | Ga0466712_205302_826_1200 | 124 |
| 132 | 3300042609 | Ga0466722_157054 | Ga0466722_157054_2328_2705 | 125 |
| 133 | 3300042610 | Ga0466698_004647 | Ga0466698_004647_323_730 | 135 |
Functional Annotation
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1adr-assembly1.cif.gz_A | DETERMINATION OF THE NUCLEAR MAGNETIC RESONANCE STRUCTURE OF THE DNA-BINDING DOMAIN OF THE P22 C2 REPRESSOR (1-76) IN SOLUTION AND COMPARISON WITH THE DNA-BINDING DOMAIN OF THE 434 REPRESSOR | 0.944 | 7 | 65 |
| 3zkc-assembly1.cif.gz_A | Crystal structure of the master regulator for biofilm formation SinR in complex with DNA. | 0.938 | 8 | 65 |
| 1y7y-assembly1.cif.gz_B | High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila | 0.937 | 6 | 66 |
| 1y7y-assembly1.cif.gz_A | High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila | 0.935 | 7 | 66 |
| 7t8i-assembly1.cif.gz_B | Crystal structure of the ImmR transcriptional regulator DNA-binding domain of Bacillus subtilis | 0.933 | 7 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1adrA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9436 | 7 | 65 | 1.10.260.40 |
| 3zkcA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9377 | 8 | 65 | 1.10.260.40 |
| 3qq6B00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9374 | 6 | 68 | 1.10.260.40 |
| 1y7yB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9368 | 6 | 66 | 1.10.260.40 |
| 1y7yA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9355 | 7 | 66 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3E1RH47-F1-model_v4 | HTH cro/C1-type domain-containing protein | 0.9691 | 1 | 67 |
GO:0005829
GO:0003677 GO:0003700 |
| AF-A0A7X7AKY5-F1-model_v4 | Uncharacterized/unreviewed | 0.9687 | 3 | 67 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.56 | 0.63 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.