Protein Family IF05200

Metagenome Isolate
121 Members
54 Samples
108 Scaffolds
290.89 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_269642|Ga0466696_269642_1280_2215
Length
311 aa
Sequence
MSKPVKLTINEIMERNMKLLIFFFLISMCVLGQENNKILEQDAVVEKLADGFRFTEGPAVDPEGNIYFTDQPDDRIFKWSVEEGKLSVFHENAGRANGLYFDKQGYLLSCSDMNNEIRQIDMNGNHAVLVADFDGKRLNGPNDLWVDPAGGIYFTDPLYKRDYWTRSPEMQQDGEHVYYLSPVTKKLIRVTTDLEKPNGIIGAPDGKSLYVADIKAGKTYSYEIQPDGTLTNKKLFAAMGSDGMTIDREGNIYLTGKGVTVFNTQGEQIAHIPVEAGWTANVCFGGKDMKTLFITASENLYSLKMNVAGNK

📊 Sample Types

Isolate 10.7%
Metagenome 89.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.7%
Blattidae 24.5%
Kalotermitidae 22.6%
Termopsidae 5.7%
Unclassified 3.8%
Rhinotermitidae 1.9%
Passalidae 1.9%
Drosophilidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
2 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
3 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
11 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
12 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
13 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
14 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
22 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
25 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
26 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
27 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
32 3300007507 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut Metagenome Drosophilidae
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
35 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
36 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
37 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
38 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
39 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
40 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
41 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
42 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
43 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
44 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
45 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
46 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
47 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
50 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
51 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
52 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
53 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
54 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0068302_10064268 3300005071 Bacteria 3372
2 Ga0466713_124834 3300042602 Bacteria 50546
3 Ga0466716_093504 3300042605 Bacteria 6208
4 Ga0466698_278986 3300042610 Bacteria 2004
5 Ga0466711_053834 3300042615 Bacteria 10425
6 Ga0466726_284088 3300042619 Bacteria 8137
7 Ga0466705_077431 3300042612 Bacteria 39083
8 Ga0466705_105833 3300042612 Unclassified 15303
9 Ga0466704_065871 3300042643 Bacteria 5565
10 Ga0466709_179897 3300042648 Bacteria 4659
11 Ga0466727_227555 3300042655 Bacteria 10119
12 Ga0123353_10946430 3300010167 Unclassified 1166
13 Ga0123354_10000740 3300010882 Bacteria 35242
14 Ga0123354_10014170 3300010882 Bacteria 12405
15 IMNBL1DRAFT_c0002376 3300000062 Bacteria 13165
16 JGI24702J35022_10010068 3300002462 Bacteria 5296
17 JGI24702J35022_10012719 3300002462 Bacteria 4671
18 JGI24705J35276_12234033 3300002504 Bacteria 5206
19 Ga0068302_10086754 3300005071 Unclassified 5793
20 Ga0123357_10000222 3300009784 Bacteria 53766
21 Ga0466701_074586 3300042598 Bacteria 17388
22 Ga0466696_276840 3300042596 Bacteria 11317
23 Ga0466697_233747 3300042611 Bacteria 1680
24 Ga0466727_349423 3300042655 Bacteria 30219
25 Ga0466729_303287 3300042621 Bacteria 3669
26 Ga0466703_156923 3300042636 Bacteria 12903
27 Ga0466704_172850 3300042643 Bacteria 4302
28 Ga0466709_030205 3300042648 Bacteria 36078
29 Ga0466708_023581 3300042652 Bacteria 13912
30 Ga0123357_10034215 3300009784 Bacteria 6905
31 Ga0123357_10094374 3300009784 Bacteria 3883
32 Ga0123357_10229993 3300009784 Bacteria 2035
33 Ga0123353_10845582 3300010167 Bacteria 1255
34 Ga0068305_10009904 3300005083 Bacteria 41398
35 Ga0466713_145232 3300042602 Bacteria 13657
36 Ga0466690_155525 3300042590 Bacteria 2348
37 Ga0466693_005260 3300042592 Bacteria 2214
38 Ga0466696_227766 3300042596 Bacteria 8952
39 Ga0466715_496574 3300042616 Bacteria 33816
40 Ga0466733_000983 3300042659 Bacteria 4787
41 Ga0466734_019092 3300042623 Bacteria 2275
42 Ga0466703_179299 3300042636 Bacteria 6481
43 Ga0466704_473112 3300042643 Bacteria 2864
44 Ga0123356_10403893 3300010049 Bacteria 1504
45 Ga0123354_10136174 3300010882 Bacteria 3069
46 IMNBL1DRAFT_c0006457 3300000062 Bacteria 6398
47 Ga0068305_10015112 3300005083 Bacteria 28238
48 Ga0105008_1001327 3300007507 Bacteria 10148
49 Ga0466700_012083 3300042600 Bacteria 1234
50 Ga0466713_002336 3300042602 Bacteria 15603
51 Ga0466713_135582 3300042602 Bacteria 25846
52 Ga0466713_137499 3300042602 Bacteria 46639
53 Ga0466728_131950 3300042620 Bacteria 16045
54 Ga0466733_053599 3300042659 Bacteria 11464
55 Ga0466733_173674 3300042659 Bacteria 23559
56 Ga0466703_391743 3300042636 Bacteria 10391
57 Ga0466704_025792 3300042643 Bacteria 7110
58 Ga0466704_108172 3300042643 Bacteria 11724
59 Ga0123357_10008660 3300009784 Bacteria 12742
60 Ga0123353_10497304 3300010167 Bacteria 1778
61 Ga0123354_10009800 3300010882 Bacteria 14720
62 JGI24702J35022_10137434 3300002462 Bacteria 1361
63 JGI24702J35022_10181470 3300002462 Unclassified 1196
64 JGI24702J35022_10207208 3300002462 Bacteria 1124
65 Ga0072941_1322262 3300005201 Bacteria 2936
66 Ga0466719_292822 3300042606 Bacteria 42754
67 Ga0466718_106684 3300042617 Bacteria 1465
68 Ga0466705_156114 3300042612 Bacteria 14228
69 Ga0466733_198400 3300042659 Bacteria 123976
70 Ga0466709_232520 3300042648 Bacteria 1381
71 Ga0123353_10338374 3300010167 Bacteria 2274
72 Ga0123354_10006093 3300010882 Bacteria 17804
73 Ga0123354_10045198 3300010882 Bacteria 6742
74 IMNBL1DRAFT_c0008094 3300000062 Bacteria 5410
75 JGI24702J35022_10001981 3300002462 Bacteria 12632
76 Ga0068305_10014814 3300005083 Bacteria 7051
77 Ga0466720_218974 3300042607 Bacteria 2062
78 Ga0466698_507815 3300042610 Bacteria 2848
79 Ga0466690_023676 3300042590 Bacteria 5965
80 Ga0466728_465265 3300042620 Bacteria 10150
81 Ga0466705_236763 3300042612 Bacteria 1359
82 Ga0466729_246228 3300042621 Bacteria 3185
83 Ga0466704_131219 3300042643 Bacteria 2916
84 Ga0466704_194655 3300042643 Bacteria 4583
85 Ga0466704_559902 3300042643 Bacteria 1367
86 Ga0466708_169565 3300042652 Bacteria 34312
87 Ga0123354_10208163 3300010882 Bacteria 2124
88 JGI24702J35022_10002441 3300002462 Bacteria 11336
89 JGI24702J35022_10033728 3300002462 Bacteria 2737
90 Ga0072940_1282733 3300005200 Bacteria 1041
91 Ga0466656_258754 3300042550 Bacteria 1082
92 Ga0466696_017777 3300042596 Bacteria 7192
93 Ga0466696_269642 3300042596 Bacteria 17732
94 Ga0466715_366697 3300042616 Bacteria 28419
95 Ga0466733_205403 3300042659 Bacteria 50942
96 Ga0466731_280303 3300042622 Bacteria 5778
97 Ga0466704_537570 3300042643 Bacteria 25299
98 Ga0466727_040337 3300042655 Bacteria 31698
99 Ga0123356_10010524 3300010049 Bacteria 9073
100 Ga0123353_10083111 3300010167 Bacteria 5152
101 JGI24702J35022_10000797 3300002462 Bacteria 19502
102 Ga0466700_084482 3300042600 Bacteria 13770
103 Ga0466700_402810 3300042600 Bacteria 14043
104 Ga0466657_080118 3300042582 Bacteria 1509
105 Ga0466694_327510 3300042594 Bacteria 2575
106 Ga0466696_399641 3300042596 Bacteria 27432
107 Ga0466715_586714 3300042616 Bacteria 57830
108 Ga0466726_072101 3300042619 Bacteria 6736

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_025792 Ga0466704_025792_776_1633 250
2 3300042620 Ga0466728_131950 Ga0466728_131950_14513_15370 251
3 3300005071 Ga0068302_10086754 Ga0068302_100867543 253
4 3300042596 Ga0466696_276840 Ga0466696_276840_8249_9109 254
5 3300042643 Ga0466704_172850 Ga0466704_172850_658_1557 257
6 3300010167 Ga0123353_10946430 Ga0123353_109464301 261
7 3300042643 Ga0466704_473112 Ga0466704_473112_1805_2704 263
8 3300042655 Ga0466727_227555 Ga0466727_227555_1658_2527 263
9 3300042643 Ga0466704_065871 Ga0466704_065871_671_1570 264
10 3300042600 Ga0466700_012083 Ga0466700_012083_163_1056 266
11 3300042616 Ga0466715_366697 Ga0466715_366697_11074_11973 266
12 3300042643 Ga0466704_108172 Ga0466704_108172_10590_11489 266
13 3300010882 Ga0123354_10009800 Ga0123354_100098009 267
14 3300042602 Ga0466713_002336 Ga0466713_002336_5247_6176 268
15 3300042612 Ga0466705_236763 Ga0466705_236763_115_1011 268
16 3300042659 Ga0466733_205403 Ga0466733_205403_11891_12790 268
17 3300042612 Ga0466705_077431 Ga0466705_077431_18166_19077 269
18 3300042636 Ga0466703_179299 Ga0466703_179299_107_1006 270
19 3300042643 Ga0466704_131219 Ga0466704_131219_1968_2879 270
20 3300002462 JGI24702J35022_10033728 JGI24702J35022_100337283 271
21 3300010049 Ga0123356_10010524 Ga0123356_100105244 272
22 3300010882 Ga0123354_10014170 Ga0123354_1001417010 272
23 3300010882 Ga0123354_10006093 Ga0123354_1000609318 276
24 3300042619 Ga0466726_072101 Ga0466726_072101_3749_4624 281
25 3300042621 Ga0466729_246228 Ga0466729_246228_444_1289 281
26 3300042607 Ga0466720_218974 Ga0466720_218974_1180_2031 283
27 3300042602 Ga0466713_135582 Ga0466713_135582_23927_24781 284
28 3300042602 Ga0466713_137499 Ga0466713_137499_6092_6946 284
29 3300042612 Ga0466705_105833 Ga0466705_105833_14332_15186 284
30 3300042643 Ga0466704_537570 Ga0466704_537570_9992_10846 284
31 3300042648 Ga0466709_179897 Ga0466709_179897_1245_2102 285
32 3300010049 Ga0123356_10403893 Ga0123356_104038932 286
33 3300042659 Ga0466733_173674 Ga0466733_173674_2165_3025 286
34 3300042636 Ga0466703_156923 Ga0466703_156923_10554_11417 287
35 3300002462 JGI24702J35022_10181470 JGI24702J35022_101814701 288
36 3300042596 Ga0466696_227766 Ga0466696_227766_7310_8176 288
37 3300042600 Ga0466700_402810 Ga0466700_402810_9658_10551 288
38 3300002462 JGI24702J35022_10002441 JGI24702J35022_100024417 291
39 3300007507 Ga0105008_1001327 Ga0105008_100132713 292
40 3300042590 Ga0466690_155525 Ga0466690_155525_1004_1882 292
41 3300042606 Ga0466719_292822 Ga0466719_292822_34753_35631 292
42 3300042617 Ga0466718_106684 Ga0466718_106684_547_1425 292
43 3300042619 Ga0466726_284088 Ga0466726_284088_346_1224 292
44 3300042652 Ga0466708_169565 Ga0466708_169565_12675_13553 292
45 3300042655 Ga0466727_349423 Ga0466727_349423_19577_20455 292
46 3300005083 Ga0068305_10009904 Ga0068305_1000990424 293
47 3300010882 Ga0123354_10208163 Ga0123354_102081632 293
48 3300042550 Ga0466656_258754 Ga0466656_258754_20_907 295
49 3300042602 Ga0466713_145232 Ga0466713_145232_8639_9526 295
50 3300042600 Ga0466700_084482 Ga0466700_084482_310_1203 297
51 3300042610 Ga0466698_507815 Ga0466698_507815_646_1539 297
52 3300042623 Ga0466734_019092 Ga0466734_019092_935_1828 297
53 iso_pr_bacteria 2940209341 2940211281 297
54 3300000062 IMNBL1DRAFT_c0008094 IMNBL1DRAFT_00080942 298
55 3300009784 Ga0123357_10008660 Ga0123357_1000866014 298
56 3300009784 Ga0123357_10034215 Ga0123357_100342152 298
57 3300010882 Ga0123354_10136174 Ga0123354_101361743 298
58 3300042594 Ga0466694_327510 Ga0466694_327510_1300_2196 298
59 3300042598 Ga0466701_074586 Ga0466701_074586_11095_11991 298
60 3300042611 Ga0466697_233747 Ga0466697_233747_413_1309 298
61 3300042648 Ga0466709_030205 Ga0466709_030205_32233_33129 298
62 3300042659 Ga0466733_000983 Ga0466733_000983_2062_2958 298
63 3300000062 IMNBL1DRAFT_c0002376 IMNBL1DRAFT_00023764 299
64 3300002504 JGI24705J35276_12234033 JGI24705J35276_122340335 299
65 3300009784 Ga0123357_10000222 Ga0123357_1000022218 299
66 3300009784 Ga0123357_10094374 Ga0123357_100943743 299
67 3300009784 Ga0123357_10229993 Ga0123357_102299932 299
68 3300010167 Ga0123353_10083111 Ga0123353_100831112 299
69 3300010167 Ga0123353_10338374 Ga0123353_103383743 299
70 3300010882 Ga0123354_10000740 Ga0123354_1000074024 299
71 3300042582 Ga0466657_080118 Ga0466657_080118_107_1006 299
72 3300042610 Ga0466698_278986 Ga0466698_278986_151_1050 299
73 3300042615 Ga0466711_053834 Ga0466711_053834_2083_2982 299
74 3300042616 Ga0466715_586714 Ga0466715_586714_20773_21672 299
75 3300042620 Ga0466728_465265 Ga0466728_465265_247_1146 299
76 3300042622 Ga0466731_280303 Ga0466731_280303_3796_4695 299
77 3300042643 Ga0466704_559902 Ga0466704_559902_444_1343 299
78 3300042659 Ga0466733_053599 Ga0466733_053599_3469_4368 299
79 iso_pr_bacteria 2940205530 2940207797 299
80 iso_pr_bacteria 2940212447 2940214712 299
81 iso_pr_bacteria 2940298504 2940300763 299
82 iso_pr_bacteria 2940302308 2940304566 299
83 iso_pr_bacteria 2940306115 2940308132 299
84 iso_pr_bacteria 2940309933 2940311969 299
85 iso_pr_bacteria 2940313741 2940315784 299
86 iso_pr_bacteria 2940317558 2940319597 299
87 iso_pr_bacteria 2940321370 2940323202 299
88 iso_pr_bacteria 2940325180 2940327437 299
89 iso_pr_bacteria 2940328985 2940331245 299
90 iso_pr_bacteria 2940332795 2940334836 299
91 3300002462 JGI24702J35022_10001981 JGI24702J35022_1000198110 300
92 3300002462 JGI24702J35022_10012719 JGI24702J35022_100127194 300
93 3300005071 Ga0068302_10064268 Ga0068302_100642682 300
94 3300005200 Ga0072940_1282733 Ga0072940_12827331 300
95 3300005201 Ga0072941_1322262 Ga0072941_13222623 300
96 3300010167 Ga0123353_10497304 Ga0123353_104973042 300
97 3300010167 Ga0123353_10845582 Ga0123353_108455822 300
98 3300010882 Ga0123354_10045198 Ga0123354_100451983 300
99 3300042592 Ga0466693_005260 Ga0466693_005260_71_973 300
100 3300042648 Ga0466709_232520 Ga0466709_232520_277_1179 300
101 3300042655 Ga0466727_040337 Ga0466727_040337_28437_29339 300
102 3300042596 Ga0466696_017777 Ga0466696_017777_5588_6493 301
103 3300042612 Ga0466705_156114 Ga0466705_156114_990_1895 301
104 3300042636 Ga0466703_391743 Ga0466703_391743_8392_9297 301
105 3300042643 Ga0466704_194655 Ga0466704_194655_2162_3067 301
106 3300002462 JGI24702J35022_10207208 JGI24702J35022_102072081 302
107 3300005083 Ga0068305_10014814 Ga0068305_100148145 302
108 3300005083 Ga0068305_10015112 Ga0068305_1001511239 302
109 3300042616 Ga0466715_496574 Ga0466715_496574_30583_31491 302
110 3300042652 Ga0466708_023581 Ga0466708_023581_11022_11930 302
111 3300000062 IMNBL1DRAFT_c0006457 IMNBL1DRAFT_00064577 303
112 3300002462 JGI24702J35022_10000797 JGI24702J35022_100007974 303
113 3300002462 JGI24702J35022_10010068 JGI24702J35022_100100683 303
114 3300042590 Ga0466690_023676 Ga0466690_023676_2009_2920 303
115 3300042602 Ga0466713_124834 Ga0466713_124834_28979_29890 303
116 3300042605 Ga0466716_093504 Ga0466716_093504_2757_3668 303
117 3300042596 Ga0466696_399641 Ga0466696_399641_26232_27149 305
118 3300042659 Ga0466733_198400 Ga0466733_198400_16104_17024 306
119 3300042621 Ga0466729_303287 Ga0466729_303287_113_1102 307
120 3300002462 JGI24702J35022_10137434 JGI24702J35022_101374341 310
121 3300042596 Ga0466696_269642 Ga0466696_269642_1280_2215 311

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08450 SGL SMP-30/Gluconolactonase/LRE-like region 54 297 0.9
PF01731 Arylesterase Arylesterase 152 225 0.79

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01731 GO:0004064 arylesterase activity MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3e5z-assembly2.cif.gz_B X-Ray structure of the putative gluconolactonase in protein family PF08450. Northeast Structural Genomics Consortium target DrR130. 0.93 37 311
3dr2-assembly1.cif.gz_B Structural and Functional Analyses of XC5397 from Xanthomonas campestris: A Gluconolactonase Important in Glucose Secondary Metabolic Pathways 0.927 42 305
3dr2-assembly1.cif.gz_A Structural and Functional Analyses of XC5397 from Xanthomonas campestris: A Gluconolactonase Important in Glucose Secondary Metabolic Pathways 0.914 38 305
7ris-assembly1.cif.gz_A Crystal structure of RPA3624, a beta-propeller lactonase from Rhodopseudomonas palustris, with active-site bound phosphate 0.882 46 309
8dk0-assembly1.cif.gz_A Crystal structure of RPA3624, a beta-propeller lactonase from Rhodopseudomonas palustris, with active-site bound (S)gamma-valerolactone 0.881 44 309
IDDescriptionScoreStartEndSuperfamily
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9181 37 311 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9145 38 305 2.120.10.30
af_Q4CMT7_1_81_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8571 53 121 2.40.10.500
5xfeA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8503 44 310 2.120.10.30
af_Q54ZP3_33_320_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8451 43 310 2.120.10.30
IDDescriptionScoreStartEndGO Terms
AF-A0A7V4HPV5-F1-model_v4 Uncharacterized/unreviewed 0.9928 37 310
AF-A0A4Q3F7I5-F1-model_v4 Uncharacterized/unreviewed 0.9921 48 159

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.