Protein Family IF05185

Metagenome Isolate
140 Members
53 Samples
125 Scaffolds
575.4 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_211426|Ga0466696_211426_102_1640
Length
512 aa
Sequence
LGLDAVKIPKPAGLSASQLARFRVIAGEEFVRTDGYARLSASYGKSVYDLLRMRNKIAENIPDAVIYPDSREQIEAIVSRCASEKIPLYVCGGGTSLTRGTECVRGGVSLDMRLRFNKAVGFNEVDQSVTVEAGMSGSKLETLLNNAEKEFGGKRPYTCGHFPRSFGHSTVGGWVMTGGSGRDSGYYGGIRDIVLGGDYATPSGAIFTSRYSNKAAGPDLCRIMAGSEGAFGVLTHVTLKVFRRHPDARRFACVFKDWETAQAAAREIMQAGEGFPPALRLSDPEETGVLMRVFEVTENPLGRLLEARGFRFDKMCLLEGWVGGSRGLLRGAPENERKVAARFGAFRFSGIAARLWEKYQDSVPYFRDAVQDFGFVLDTLECGVSWSNMGRVYRELRAYAGGFPRTLCMTRVEHMDPQGADLCLTFITRMRDPEEYRKFHAGFMDLVARCDACISGHYGIGKLSGPWLEGYLGRNEYAVIRALKRHFDPGNIMNPGGTLGLDLDGKDRHFWG

📊 Sample Types

Isolate 10.7%
Metagenome 89.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.7%
Unclassified 30.8%
Kalotermitidae 26.9%
Rhinotermitidae 3.8%
Termopsidae 3.8%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 1
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
2 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
10 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
11 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
12 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
17 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
24 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
25 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
26 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
27 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
30 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
31 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
35 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
36 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
37 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
38 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
39 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
41 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
42 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
43 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
44 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
45 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
46 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
47 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
48 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
49 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
50 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
51 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
52 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
53 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10395825 3300010167 Bacteria 2058
2 Ga0466690_179728 3300042590 Bacteria 9245
3 Ga0466691_076227 3300042593 Bacteria 10240
4 Ga0466691_125413 3300042593 Bacteria 15124
5 Ga0466691_128223 3300042593 Bacteria 6835
6 Ga0466703_393525 3300042636 Bacteria 72819
7 Ga0466709_035984 3300042648 Bacteria 3158
8 Ga0466709_342141 3300042648 Bacteria 17575
9 Ga0466708_227307 3300042652 Bacteria 7590
10 Ga0466708_435726 3300042652 Bacteria 7188
11 Ga0466705_434368 3300042612 Bacteria 2976
12 Ga0466712_092832 3300042614 Bacteria 12178
13 Ga0466726_167406 3300042619 Bacteria 2275
14 Ga0466714_058231 3300042603 Bacteria 3083
15 Ga0466716_375585 3300042605 Bacteria 3608
16 JGI24695J34938_10000502 3300002450 Bacteria 38047
17 JGI24695J34938_10006244 3300002450 Bacteria 7226
18 Ga0123355_10149767 3300009826 Bacteria 3548
19 Ga0123353_10135720 3300010167 Bacteria 3946
20 Ga0466692_017814 3300042591 Bacteria 21119
21 Ga0466696_015647 3300042596 Bacteria 26152
22 Ga0466705_484851 3300042612 Bacteria 21219
23 Ga0466712_113200 3300042614 Bacteria 4714
24 Ga0466711_062257 3300042615 Bacteria 8239
25 Ga0466728_383806 3300042620 Bacteria 10064
26 Ga0466721_294222 3300042608 Bacteria 5348
27 AustNasuHG_c1000099 3300000089 Bacteria 25536
28 Ga0466732_021230 3300042656 Unclassified 2622
29 Ga0123356_10002053 3300010049 Bacteria 21712
30 Ga0466704_602352 3300042643 Bacteria 8859
31 Ga0466709_249110 3300042648 Bacteria 4511
32 Ga0466709_336496 3300042648 Bacteria 5832
33 Ga0466708_315749 3300042652 Bacteria 28028
34 Ga0466711_291994 3300042615 Bacteria 7328
35 Ga0466723_061750 3300042618 Bacteria 30747
36 Ga0466723_087343 3300042618 Bacteria 15969
37 Ga0466713_098884 3300042602 Bacteria 29957
38 Ga0466716_156019 3300042605 Bacteria 2329
39 Ga0466722_112456 3300042609 Bacteria 2235
40 JGI24698J34947_10005365 3300002449 Bacteria 7030
41 JGI24702J35022_10051803 3300002462 Bacteria 2188
42 JGI24697J35500_11274741 3300002507 Bacteria 9211
43 JGI24696J40584_12950062 3300002834 Unclassified 2120
44 Ga0466732_151112 3300042656 Bacteria 2202
45 Ga0123356_10010961 3300010049 Bacteria 8855
46 Ga0123356_10076388 3300010049 Bacteria 3157
47 Ga0123353_10000539 3300010167 Bacteria 46894
48 Ga0123353_10009526 3300010167 Bacteria 13424
49 Ga0123353_10041204 3300010167 Unclassified 7293
50 Ga0123354_10153331 3300010882 Bacteria 2778
51 Ga0466692_161246 3300042591 Bacteria 3682
52 Ga0466691_097940 3300042593 Bacteria 12799
53 Ga0466704_132596 3300042643 Unclassified 11677
54 Ga0466708_127613 3300042652 Bacteria 5420
55 Ga0466712_037549 3300042614 Bacteria 7780
56 Ga0466712_059677 3300042614 Bacteria 14575
57 Ga0466718_022424 3300042617 Archaea 3120
58 Ga0466718_075321 3300042617 Unclassified 4723
59 Ga0466706_181980 3300042599 Bacteria 27558
60 Ga0466707_133939 3300042601 Bacteria 10352
61 Ga0466707_380559 3300042601 Bacteria 4178
62 Ga0466713_118055 3300042602 Bacteria 3153
63 JGI24702J35022_10010215 3300002462 Bacteria 5255
64 Ga0123356_10009052 3300010049 Bacteria 9846
65 Ga0466690_050785 3300042590 Bacteria 8238
66 Ga0466691_023024 3300042593 Unclassified 6996
67 Ga0466696_211426 3300042596 Bacteria 3739
68 Ga0466703_017139 3300042636 Bacteria 8824
69 Ga0466712_138833 3300042614 Bacteria 16191
70 Ga0466723_023190 3300042618 Bacteria 28471
71 Ga0466726_228058 3300042619 Unclassified 2665
72 Ga0466714_028521 3300042603 Bacteria 38215
73 JGI24698J34947_10000420 3300002449 Bacteria 19435
74 JGI24698J34947_10030217 3300002449 Unclassified 2858
75 JGI24695J34938_10000880 3300002450 Bacteria 27708
76 JGI24702J35022_10024595 3300002462 Bacteria 3253
77 Ga0072941_1005124 3300005201 Bacteria 25954
78 Ga0072941_1007357 3300005201 Bacteria 37252
79 Ga0123354_10085998 3300010882 Bacteria 4399
80 Ga0466704_168640 3300042643 Bacteria 16046
81 Ga0466704_188001 3300042643 Bacteria 7493
82 Ga0466711_124285 3300042615 Bacteria 5194
83 Ga0466726_193839 3300042619 Bacteria 9921
84 Ga0466706_006038 3300042599 Bacteria 1824
85 Ga0466706_075476 3300042599 Bacteria 3642
86 Ga0466719_216736 3300042606 Bacteria 7508
87 Ga0466719_326190 3300042606 Bacteria 23120
88 Ga0466722_108364 3300042609 Bacteria 6323
89 JGI24695J34938_10006003 3300002450 Bacteria 7417
90 JGI24695J34938_10008279 3300002450 Bacteria 5944
91 Ga0072941_1064262 3300005201 Bacteria 6608
92 Ga0466705_092199 3300042612 Bacteria 7440
93 Ga0466732_066149 3300042656 Bacteria 2060
94 Ga0123353_10000783 3300010167 Bacteria 38755
95 Ga0466691_000159 3300042593 Bacteria 2399
96 Ga0466699_277466 3300042597 Bacteria 6150
97 Ga0466735_080044 3300042624 Bacteria 4548
98 Ga0466704_021151 3300042643 Bacteria 26276
99 Ga0466708_033268 3300042652 Bacteria 2163
100 Ga0466712_032984 3300042614 Bacteria 15935
101 Ga0466715_007302 3300042616 Bacteria 8280
102 Ga0466715_352760 3300042616 Bacteria 2415
103 Ga0466723_208531 3300042618 Bacteria 2864
104 Ga0466726_125297 3300042619 Bacteria 2690
105 Ga0466726_455692 3300042619 Bacteria 3957
106 Ga0466707_235930 3300042601 Bacteria 15290
107 Ga0466716_051481 3300042605 Bacteria 8757
108 Ga0466719_015205 3300042606 Bacteria 10472
109 JGI24698J34947_10030200 3300002449 Bacteria 2859
110 JGI24695J34938_10000035 3300002450 Bacteria 102136
111 Ga0466693_332400 3300042592 Bacteria 40906
112 Ga0466699_262955 3300042597 Bacteria 3755
113 Ga0466703_004288 3300042636 Bacteria 14501
114 Ga0466703_177637 3300042636 Bacteria 197398
115 Ga0466712_118323 3300042614 Bacteria 21090
116 Ga0466712_318937 3300042614 Bacteria 10919
117 Ga0466711_029426 3300042615 Bacteria 19240
118 Ga0466726_025758 3300042619 Bacteria 10784
119 Ga0466726_136081 3300042619 Bacteria 2629
120 Ga0466728_123207 3300042620 Bacteria 6364
121 Ga0466713_149148 3300042602 Bacteria 35550
122 Ga0466719_036370 3300042606 Bacteria 2932
123 Ga0466722_192504 3300042609 Bacteria 17517
124 JGI24698J34947_10000067 3300002449 Bacteria 32875
125 JGI24698J34947_10026759 3300002449 Bacteria 3063

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_211426 Ga0466696_211426_102_1640 512
2 3300042648 Ga0466709_249110 Ga0466709_249110_2620_4212 530
3 3300042652 Ga0466708_033268 Ga0466708_033268_374_1969 531
4 3300042599 Ga0466706_006038 Ga0466706_006038_132_1739 535
5 3300042606 Ga0466719_216736 Ga0466719_216736_282_1889 535
6 3300042591 Ga0466692_017814 Ga0466692_017814_14051_15691 546
7 3300042620 Ga0466728_383806 Ga0466728_383806_4806_6533 546
8 3300042599 Ga0466706_181980 Ga0466706_181980_1062_2759 548
9 3300042596 Ga0466696_015647 Ga0466696_015647_7290_9035 554
10 3300042609 Ga0466722_192504 Ga0466722_192504_7310_9058 559
11 3300042601 Ga0466707_235930 Ga0466707_235930_3651_5387 560
12 3300042602 Ga0466713_098884 Ga0466713_098884_962_2659 565
13 3300042603 Ga0466714_058231 Ga0466714_058231_114_1811 565
14 3300010049 Ga0123356_10010961 Ga0123356_100109616 570
15 3300042590 Ga0466690_050785 Ga0466690_050785_3090_4805 571
16 3300042593 Ga0466691_076227 Ga0466691_076227_7806_9554 571
17 3300042593 Ga0466691_023024 Ga0466691_023024_1826_3550 574
18 3300042597 Ga0466699_262955 Ga0466699_262955_1836_3560 574
19 3300042603 Ga0466714_028521 Ga0466714_028521_24466_26190 574
20 3300042615 Ga0466711_124285 Ga0466711_124285_1170_2894 574
21 3300042618 Ga0466723_061750 Ga0466723_061750_22022_23746 574
22 3300042636 Ga0466703_004288 Ga0466703_004288_12175_13899 574
23 3300002462 JGI24702J35022_10010215 JGI24702J35022_100102153 575
24 3300042593 Ga0466691_000159 Ga0466691_000159_624_2351 575
25 3300042597 Ga0466699_277466 Ga0466699_277466_3053_4780 575
26 3300042605 Ga0466716_156019 Ga0466716_156019_553_2280 575
27 3300042616 Ga0466715_352760 Ga0466715_352760_299_2026 575
28 3300042617 Ga0466718_075321 Ga0466718_075321_1852_3579 575
29 3300042618 Ga0466723_087343 Ga0466723_087343_9716_11443 575
30 3300042620 Ga0466728_123207 Ga0466728_123207_4455_6182 575
31 3300042643 Ga0466704_168640 Ga0466704_168640_615_2342 575
32 3300042648 Ga0466709_336496 Ga0466709_336496_606_2333 575
33 3300042652 Ga0466708_127613 Ga0466708_127613_2502_4229 575
34 3300042656 Ga0466732_151112 Ga0466732_151112_79_1806 575
35 iso_pr_bacteria 2781125631 2781268187 575
36 iso_pr_bacteria 2820424542 2820425522 575
37 iso_pr_bacteria 2820429680 2820430347 575
38 iso_pr_bacteria 2820683647 2820684634 575
39 3300002450 JGI24695J34938_10008279 JGI24695J34938_100082792 576
40 3300010049 Ga0123356_10009052 Ga0123356_100090524 576
41 3300010167 Ga0123353_10000539 Ga0123353_1000053925 576
42 3300010167 Ga0123353_10000783 Ga0123353_100007835 576
43 3300010167 Ga0123353_10041204 Ga0123353_100412042 576
44 3300042605 Ga0466716_051481 Ga0466716_051481_1364_3094 576
45 3300042609 Ga0466722_112456 Ga0466722_112456_353_2083 576
46 3300042618 Ga0466723_208531 Ga0466723_208531_910_2640 576
47 3300042619 Ga0466726_167406 Ga0466726_167406_28_1758 576
48 3300042636 Ga0466703_017139 Ga0466703_017139_6700_8430 576
49 3300042643 Ga0466704_188001 Ga0466704_188001_5674_7404 576
50 3300042652 Ga0466708_435726 Ga0466708_435726_5330_7060 576
51 iso_pr_bacteria 2820240463 2820242077 576
52 iso_pr_bacteria 2820391468 2820391633 576
53 3300002462 JGI24702J35022_10024595 JGI24702J35022_100245952 577
54 3300002462 JGI24702J35022_10051803 JGI24702J35022_100518032 577
55 3300002834 JGI24696J40584_12950062 JGI24696J40584_129500622 577
56 3300010049 Ga0123356_10002053 Ga0123356_100020536 577
57 3300010167 Ga0123353_10009526 Ga0123353_100095263 577
58 3300010167 Ga0123353_10135720 Ga0123353_101357202 577
59 3300010167 Ga0123353_10395825 Ga0123353_103958252 577
60 3300042591 Ga0466692_161246 Ga0466692_161246_1591_3324 577
61 3300042599 Ga0466706_075476 Ga0466706_075476_1818_3551 577
62 3300042608 Ga0466721_294222 Ga0466721_294222_2092_3825 577
63 3300042593 Ga0466691_097940 Ga0466691_097940_8719_10455 578
64 3300042606 Ga0466719_326190 Ga0466719_326190_6960_8696 578
65 3300042614 Ga0466712_032984 Ga0466712_032984_227_1963 578
66 3300042614 Ga0466712_059677 Ga0466712_059677_385_2121 578
67 3300042614 Ga0466712_138833 Ga0466712_138833_6380_8116 578
68 3300042615 Ga0466711_291994 Ga0466711_291994_1363_3099 578
69 3300042624 Ga0466735_080044 Ga0466735_080044_391_2127 578
70 iso_pr_bacteria 2781125630 2781267299 578
71 iso_pr_bacteria 2781125635 2781276986 578
72 iso_pr_bacteria 2781125636 2781280874 578
73 iso_pr_bacteria 2781125644 2781296253 578
74 iso_pr_bacteria 2781125644 2781297301 578
75 iso_pr_bacteria 2781125645 2781297720 578
76 iso_pr_bacteria 2781125646 2781301751 578
77 3300002449 JGI24698J34947_10000067 JGI24698J34947_1000006722 579
78 3300002449 JGI24698J34947_10005365 JGI24698J34947_100053655 579
79 3300002450 JGI24695J34938_10000035 JGI24695J34938_1000003536 579
80 3300002450 JGI24695J34938_10000502 JGI24695J34938_1000050231 579
81 3300002450 JGI24695J34938_10000880 JGI24695J34938_1000088026 579
82 3300002450 JGI24695J34938_10006244 JGI24695J34938_100062444 579
83 3300002507 JGI24697J35500_11274741 JGI24697J35500_112747412 579
84 3300005201 Ga0072941_1005124 Ga0072941_100512416 579
85 3300005201 Ga0072941_1007357 Ga0072941_100735723 579
86 3300005201 Ga0072941_1064262 Ga0072941_10642626 579
87 3300042593 Ga0466691_128223 Ga0466691_128223_1163_2902 579
88 3300042601 Ga0466707_133939 Ga0466707_133939_2020_3759 579
89 3300042605 Ga0466716_375585 Ga0466716_375585_1606_3345 579
90 3300042612 Ga0466705_484851 Ga0466705_484851_12585_14324 579
91 3300042615 Ga0466711_029426 Ga0466711_029426_4564_6303 579
92 3300042615 Ga0466711_062257 Ga0466711_062257_495_2234 579
93 3300042619 Ga0466726_455692 Ga0466726_455692_2078_3817 579
94 3300042648 Ga0466709_035984 Ga0466709_035984_1350_3089 579
95 3300042648 Ga0466709_342141 Ga0466709_342141_3757_5496 579
96 3300042652 Ga0466708_227307 Ga0466708_227307_5535_7274 579
97 3300042656 Ga0466732_066149 Ga0466732_066149_296_2035 579
98 3300000089 AustNasuHG_c1000099 AustNasuHG_10000994 580
99 3300010049 Ga0123356_10076388 Ga0123356_100763882 580
100 3300010882 Ga0123354_10085998 Ga0123354_100859983 580
101 3300042590 Ga0466690_179728 Ga0466690_179728_315_2057 580
102 3300042592 Ga0466693_332400 Ga0466693_332400_15110_16852 580
103 3300042593 Ga0466691_125413 Ga0466691_125413_6776_8518 580
104 3300042601 Ga0466707_380559 Ga0466707_380559_804_2546 580
105 3300042602 Ga0466713_118055 Ga0466713_118055_90_1832 580
106 3300042602 Ga0466713_149148 Ga0466713_149148_31519_33261 580
107 3300042606 Ga0466719_015205 Ga0466719_015205_4933_6675 580
108 3300042612 Ga0466705_092199 Ga0466705_092199_5313_7055 580
109 3300042614 Ga0466712_037549 Ga0466712_037549_5167_6909 580
110 3300042614 Ga0466712_092832 Ga0466712_092832_3955_5697 580
111 3300042614 Ga0466712_113200 Ga0466712_113200_1553_3295 580
112 3300042614 Ga0466712_118323 Ga0466712_118323_7342_9084 580
113 3300042614 Ga0466712_318937 Ga0466712_318937_3141_4883 580
114 3300042616 Ga0466715_007302 Ga0466715_007302_1405_3147 580
115 3300042617 Ga0466718_022424 Ga0466718_022424_311_2053 580
116 3300042618 Ga0466723_023190 Ga0466723_023190_13551_15293 580
117 3300042619 Ga0466726_025758 Ga0466726_025758_782_2524 580
118 3300042619 Ga0466726_125297 Ga0466726_125297_350_2092 580
119 3300042619 Ga0466726_136081 Ga0466726_136081_793_2535 580
120 3300042619 Ga0466726_193839 Ga0466726_193839_3261_5003 580
121 3300042619 Ga0466726_228058 Ga0466726_228058_652_2394 580
122 3300042636 Ga0466703_177637 Ga0466703_177637_30749_32491 580
123 3300042636 Ga0466703_393525 Ga0466703_393525_59377_61119 580
124 3300042643 Ga0466704_132596 Ga0466704_132596_4530_6272 580
125 3300042643 Ga0466704_602352 Ga0466704_602352_959_2701 580
126 3300042656 Ga0466732_021230 Ga0466732_021230_219_1961 580
127 iso_pr_bacteria 2781125687 2781420792 580
128 iso_pr_bacteria 2781125689 2781426664 580
129 3300002449 JGI24698J34947_10000420 JGI24698J34947_1000042010 581
130 3300002449 JGI24698J34947_10026759 JGI24698J34947_100267592 581
131 3300002449 JGI24698J34947_10030200 JGI24698J34947_100302002 581
132 3300002449 JGI24698J34947_10030217 JGI24698J34947_100302172 581
133 3300002450 JGI24695J34938_10006003 JGI24695J34938_100060034 581
134 3300009826 Ga0123355_10149767 Ga0123355_101497672 582
135 3300042652 Ga0466708_315749 Ga0466708_315749_1080_2828 582
136 3300010882 Ga0123354_10153331 Ga0123354_101533312 583
137 3300042609 Ga0466722_108364 Ga0466722_108364_2030_3781 583
138 3300042643 Ga0466704_021151 Ga0466704_021151_19385_21175 596
139 3300042612 Ga0466705_434368 Ga0466705_434368_86_1897 603
140 3300042606 Ga0466719_036370 Ga0466719_036370_682_2529 615

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01565 FAD_binding_4 FAD binding domain 62 208 0.92
PF02913 FAD-oxidase_C FAD linked oxidases, C-terminal domain 249 496 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01565 GO:0050660 flavin adenine dinucleotide binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.