Protein Family IF05159

Metagenome Isolate
128 Members
66 Samples
101 Scaffolds
280.92 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_162181|Ga0466696_162181_1048_2049
Length
333 aa
Sequence
LHPKVRKIIVFVNLLKSFAVTFSIFWQLHSFCVILYKNLLPKSLKNSIIMILIADSGSTKTHWCVIDSAGMKKEIFTEGINPFFQSKDEISEQLNIHLLPGLAGFPIGEIHYYGAGCAFAEQKQLLRNTFNTYFKDTSICVESDLTAAARSLFNKKQGIACILGTGSNSCLYDGEKIVANISPLGFILGDEGSAAVLGRQLVADCLKNQLPDGLRGKFLEKFHLTPQLILDKVYKNPFPNRFLAGLSVFLKENIEHQAMYDIVYNGFKSFFIRNVMQYPLEGEKVGFVGSTAYHYRDILGKVAVDLGLSIDRIVQNPMQGLVKYHAPKSAINP

📊 Sample Types

Isolate 21.1%
Metagenome 78.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 33.8%
Termitidae 20.0%
Kalotermitidae 20.0%
Termopsidae 6.2%
Unclassified 6.2%
Passalidae 4.6%
Rhinotermitidae 4.6%
Hodotermitidae 1.5%
Daphniidae 1.5%
Armadillidiidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
2 2923982719 Parabacteroides sp. 52 Isolate Blattidae
3 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
4 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
5 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
6 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
15 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
19 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
22 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
23 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
24 2998907766 Penaeicola halotolerans LMIT005 Isolate
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
31 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
32 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
33 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
34 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
35 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
38 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
39 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
40 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
41 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
44 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
45 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
46 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
47 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
48 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
49 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
50 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
54 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
55 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
56 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
57 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
58 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
59 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
60 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
61 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
62 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
63 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
64 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
65 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
66 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_028558 3300042612 Bacteria 6701
2 Ga0466733_033877 3300042659 Bacteria 14620
3 Ga0466733_046116 3300042659 Bacteria 8568
4 Ga0466735_114794 3300042624 Bacteria 4212
5 Ga0466703_034925 3300042636 Bacteria 3007
6 Ga0466704_049231 3300042643 Bacteria 22613
7 IMNBGM34_c000247 3300000036 Bacteria 15623
8 Ga0466710_075847 3300042613 Unclassified 1803
9 Ga0466715_096056 3300042616 Bacteria 15121
10 Ga0466715_237164 3300042616 Bacteria 20763
11 Ga0466690_166974 3300042590 Bacteria 8525
12 Ga0466690_434165 3300042590 Bacteria 3865
13 Ga0466696_087475 3300042596 Bacteria 1787
14 Ga0466696_483171 3300042596 Bacteria 9347
15 Ga0466713_107938 3300042602 Bacteria 8396
16 Ga0466713_152405 3300042602 Bacteria 3490
17 Ga0466719_107594 3300042606 Bacteria 2181
18 Ga0466704_136764 3300042643 Bacteria 15064
19 Ga0466727_197710 3300042655 Bacteria 5257
20 JGI24702J35022_10005012 3300002462 Bacteria 7812
21 JGI24702J35022_10044597 3300002462 Bacteria 2363
22 JGI24705J35276_12233376 3300002504 Bacteria 4812
23 Ga0123356_10068014 3300010049 Bacteria 3336
24 Ga0466707_059896 3300042601 Bacteria 59431
25 Ga0466714_073904 3300042603 Bacteria 61298
26 Ga0466719_205882 3300042606 Unclassified 8043
27 Ga0466719_238354 3300042606 Bacteria 9338
28 Ga0466705_346364 3300042612 Bacteria 12239
29 Ga0466709_131721 3300042648 Bacteria 14408
30 Ga0466709_279841 3300042648 Bacteria 3297
31 Ga0466711_111812 3300042615 Bacteria 23852
32 Ga0466711_161950 3300042615 Bacteria 19092
33 Ga0466729_095279 3300042621 Bacteria 2066
34 Ga0466696_360004 3300042596 Bacteria 7539
35 Ga0466707_365431 3300042601 Bacteria 1967
36 Ga0466722_012183 3300042609 Bacteria 3065
37 Ga0466735_069265 3300042624 Bacteria 1559
38 Ga0466704_394283 3300042643 Bacteria 16919
39 JGI24702J35022_10002123 3300002462 Bacteria 12244
40 Ga0466723_182115 3300042618 Bacteria 26621
41 Ga0466723_358752 3300042618 Bacteria 15515
42 Ga0466728_150006 3300042620 Bacteria 11185
43 Ga0123357_10373871 3300009784 Bacteria 1332
44 Ga0123353_10001608 3300010167 Bacteria 27844
45 Ga0123353_10241010 3300010167 Bacteria 2810
46 Ga0466701_081176 3300042598 Bacteria 3187
47 Ga0466706_012634 3300042599 Bacteria 153886
48 Ga0466706_280381 3300042599 Bacteria 1888
49 Ga0466707_403544 3300042601 Bacteria 1839
50 Ga0466713_066880 3300042602 Bacteria 4876
51 Ga0466719_431957 3300042606 Bacteria 11641
52 Ga0466729_226983 3300042621 Bacteria 3294
53 Ga0466709_193352 3300042648 Bacteria 6373
54 Ga0466727_306769 3300042655 Bacteria 5490
55 Ga0068302_10108436 3300005071 Bacteria 2216
56 Ga0466711_175468 3300042615 Bacteria 11113
57 Ga0466715_157977 3300042616 Bacteria 113033
58 Ga0466715_629769 3300042616 Bacteria 55391
59 Ga0160455_100032 3300012837 Bacteria 317366
60 Ga0466694_406908 3300042594 Bacteria 1220
61 Ga0123353_10786050 3300010167 Bacteria 1317
62 Ga0466701_040890 3300042598 Bacteria 3747
63 Ga0466706_131181 3300042599 Bacteria 2345
64 Ga0466713_138192 3300042602 Bacteria 1996
65 Ga0466716_105392 3300042605 Bacteria 15117
66 Ga0466722_250757 3300042609 Bacteria 2681
67 Ga0466705_332762 3300042612 Bacteria 2091
68 Ga0466732_240397 3300042656 Bacteria 2135
69 Ga0466703_042108 3300042636 Bacteria 7873
70 Ga0466704_244534 3300042643 Bacteria 2938
71 Ga0466708_248388 3300042652 Bacteria 26537
72 JGI24699J35502_11134151 3300002509 Bacteria 37990
73 Ga0466710_035736 3300042613 Bacteria 3284
74 Ga0466723_082619 3300042618 Bacteria 11941
75 Ga0466699_259475 3300042597 Bacteria 1771
76 Ga0466713_097044 3300042602 Bacteria 5134
77 Ga0466716_276407 3300042605 Bacteria 7976
78 Ga0466705_020993 3300042612 Bacteria 22117
79 Ga0466709_324842 3300042648 Bacteria 9067
80 Ga0466708_137096 3300042652 Bacteria 15403
81 Ga0466711_019559 3300042615 Bacteria 4396
82 Ga0466723_133891 3300042618 Bacteria 2923
83 Ga0466696_164799 3300042596 Bacteria 6028
84 Ga0466706_095185 3300042599 Bacteria 1254
85 Ga0466706_245433 3300042599 Bacteria 30684
86 Ga0466719_498757 3300042606 Bacteria 13599
87 Ga0466705_129010 3300042612 Bacteria 10525
88 Ga0466705_295679 3300042612 Bacteria 9981
89 Ga0466735_226614 3300042624 Bacteria 1339
90 2227499631 2225789004 Bacteria 19462
91 IMNBL1DRAFT_c0005653 3300000062 Bacteria 7074
92 Ga0466711_313652 3300042615 Bacteria 18502
93 Ga0466726_039740 3300042619 Bacteria 3212
94 Ga0466726_375443 3300042619 Bacteria 1467
95 Ga0466729_090628 3300042621 Bacteria 19953
96 Ga0466729_112060 3300042621 Bacteria 15943
97 Ga0466696_162181 3300042596 Bacteria 4185
98 Ga0123353_10089808 3300010167 Bacteria 4947
99 Ga0466706_248980 3300042599 Bacteria 2750
100 Ga0466716_042076 3300042605 Bacteria 10959
101 Ga0466716_319201 3300042605 Bacteria 3709

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_248980 Ga0466706_248980_1928_2677 249
2 3300042618 Ga0466723_182115 Ga0466723_182115_20235_20993 252
3 3300042643 Ga0466704_049231 Ga0466704_049231_12949_13779 253
4 3300042618 Ga0466723_358752 Ga0466723_358752_8846_9688 258
5 3300042648 Ga0466709_131721 Ga0466709_131721_5438_6280 260
6 3300002462 JGI24702J35022_10002123 JGI24702J35022_100021238 268
7 3300042601 Ga0466707_403544 Ga0466707_403544_855_1682 275
8 3300042620 Ga0466728_150006 Ga0466728_150006_3695_4522 275
9 3300042652 Ga0466708_248388 Ga0466708_248388_778_1620 275
10 3300042612 Ga0466705_028558 Ga0466705_028558_3982_4812 276
11 3300042643 Ga0466704_244534 Ga0466704_244534_1558_2388 276
12 3300042643 Ga0466704_394283 Ga0466704_394283_3855_4685 276
13 iso_pr_bacteria 2940205530 2940208926 276
14 iso_pr_bacteria 2940212447 2940215817 276
15 iso_pr_bacteria 2940298504 2940301894 276
16 iso_pr_bacteria 2940302308 2940305673 276
17 iso_pr_bacteria 2940306115 2940309483 276
18 iso_pr_bacteria 2940309933 2940313343 276
19 iso_pr_bacteria 2940313741 2940317134 276
20 iso_pr_bacteria 2940317558 2940320971 276
21 iso_pr_bacteria 2940321370 2940324728 276
22 iso_pr_bacteria 2940325180 2940328543 276
23 iso_pr_bacteria 2940328985 2940332350 276
24 iso_pr_bacteria 2940332795 2940336186 276
25 3300042590 Ga0466690_434165 Ga0466690_434165_418_1251 277
26 3300042596 Ga0466696_087475 Ga0466696_087475_759_1592 277
27 3300042596 Ga0466696_164799 Ga0466696_164799_1192_2025 277
28 3300042599 Ga0466706_245433 Ga0466706_245433_4038_4871 277
29 3300042605 Ga0466716_105392 Ga0466716_105392_4068_4901 277
30 3300042605 Ga0466716_276407 Ga0466716_276407_3134_3967 277
31 3300042606 Ga0466719_498757 Ga0466719_498757_8180_9013 277
32 3300042612 Ga0466705_295679 Ga0466705_295679_3705_4538 277
33 3300042615 Ga0466711_111812 Ga0466711_111812_16349_17182 277
34 3300042615 Ga0466711_161950 Ga0466711_161950_16016_16849 277
35 3300042615 Ga0466711_313652 Ga0466711_313652_14641_15474 277
36 3300042616 Ga0466715_157977 Ga0466715_157977_57916_58749 277
37 3300042616 Ga0466715_237164 Ga0466715_237164_12021_12854 277
38 3300042618 Ga0466723_082619 Ga0466723_082619_1209_2042 277
39 3300042618 Ga0466723_133891 Ga0466723_133891_1330_2163 277
40 3300042621 Ga0466729_112060 Ga0466729_112060_1122_1955 277
41 3300042648 Ga0466709_193352 Ga0466709_193352_2641_3474 277
42 3300042648 Ga0466709_279841 Ga0466709_279841_209_1042 277
43 3300042648 Ga0466709_324842 Ga0466709_324842_3114_3947 277
44 iso_pr_bacteria 2923982719 2923982772 277
45 3300042609 Ga0466722_250757 Ga0466722_250757_496_1332 278
46 3300042624 Ga0466735_069265 Ga0466735_069265_376_1212 278
47 3300042652 Ga0466708_137096 Ga0466708_137096_9645_10481 278
48 iso_pr_bacteria 2820757377 2820758915 278
49 iso_pr_bacteria 2940202316 2940203796 278
50 3300002509 JGI24699J35502_11134151 JGI24699J35502_111341517 279
51 3300042599 Ga0466706_131181 Ga0466706_131181_909_1748 279
52 3300042601 Ga0466707_059896 Ga0466707_059896_46316_47155 279
53 3300042602 Ga0466713_138192 Ga0466713_138192_1030_1869 279
54 3300042619 Ga0466726_039740 Ga0466726_039740_2021_2860 279
55 3300042655 Ga0466727_306769 Ga0466727_306769_2688_3527 279
56 3300042659 Ga0466733_033877 Ga0466733_033877_2952_3791 279
57 3300042659 Ga0466733_046116 Ga0466733_046116_4006_4845 279
58 iso_pr_bacteria 2940199050 2940200194 279
59 iso_pr_bacteria 2940216256 2940217873 279
60 iso_pr_bacteria 2940346213 2940347811 279
61 3300042599 Ga0466706_095185 Ga0466706_095185_398_1240 280
62 3300042601 Ga0466707_365431 Ga0466707_365431_937_1779 280
63 3300042603 Ga0466714_073904 Ga0466714_073904_53456_54298 280
64 3300042613 Ga0466710_035736 Ga0466710_035736_131_973 280
65 3300042616 Ga0466715_629769 Ga0466715_629769_36455_37297 280
66 3300042621 Ga0466729_095279 Ga0466729_095279_417_1259 280
67 3300042636 Ga0466703_034925 Ga0466703_034925_13_855 280
68 iso_pr_bacteria 2940193328 2940193675 280
69 iso_pr_bacteria 2940209341 2940210741 280
70 iso_pr_bacteria 2940336608 2940336954 280
71 3300000036 IMNBGM34_c000247 IMNBGM34_00024710 281
72 3300000062 IMNBL1DRAFT_c0005653 IMNBL1DRAFT_00056536 281
73 3300042602 Ga0466713_066880 Ga0466713_066880_505_1350 281
74 3300042613 Ga0466710_075847 Ga0466710_075847_132_977 281
75 3300042624 Ga0466735_114794 Ga0466735_114794_1901_2746 281
76 iso_pr_bacteria 2910949487 2910952325 281
77 2225789004 2227499631 2227980904 282
78 3300002462 JGI24702J35022_10005012 JGI24702J35022_100050123 282
79 3300010049 Ga0123356_10068014 Ga0123356_100680144 282
80 3300010167 Ga0123353_10001608 Ga0123353_1000160810 282
81 3300010167 Ga0123353_10786050 Ga0123353_107860502 282
82 3300012837 Ga0160455_100032 Ga0160455_100032158 282
83 3300042596 Ga0466696_483171 Ga0466696_483171_6819_7667 282
84 3300042599 Ga0466706_280381 Ga0466706_280381_858_1706 282
85 3300042602 Ga0466713_107938 Ga0466713_107938_1715_2563 282
86 3300042605 Ga0466716_042076 Ga0466716_042076_4413_5261 282
87 3300042606 Ga0466719_205882 Ga0466719_205882_3499_4347 282
88 3300042612 Ga0466705_332762 Ga0466705_332762_232_1080 282
89 3300042619 Ga0466726_375443 Ga0466726_375443_293_1141 282
90 3300042621 Ga0466729_226983 Ga0466729_226983_2432_3280 282
91 3300042624 Ga0466735_226614 Ga0466735_226614_289_1137 282
92 iso_pr_bacteria 2998907766 2998910569 282
93 3300002504 JGI24705J35276_12233376 JGI24705J35276_122333764 283
94 3300042596 Ga0466696_360004 Ga0466696_360004_6010_6861 283
95 3300042602 Ga0466713_097044 Ga0466713_097044_2208_3059 283
96 3300042602 Ga0466713_152405 Ga0466713_152405_2398_3249 283
97 3300042606 Ga0466719_107594 Ga0466719_107594_695_1546 283
98 3300042606 Ga0466719_238354 Ga0466719_238354_7930_8781 283
99 3300042612 Ga0466705_020993 Ga0466705_020993_17535_18386 283
100 3300042612 Ga0466705_129010 Ga0466705_129010_7595_8446 283
101 3300042621 Ga0466729_090628 Ga0466729_090628_1030_1881 283
102 iso_pr_bacteria 2609459943 2610742898 283
103 iso_pr_bacteria 2830041218 2830043807 283
104 3300010167 Ga0123353_10089808 Ga0123353_100898083 284
105 3300010167 Ga0123353_10241010 Ga0123353_102410102 284
106 3300042590 Ga0466690_166974 Ga0466690_166974_3273_4127 284
107 3300042615 Ga0466711_175468 Ga0466711_175468_819_1676 285
108 3300042616 Ga0466715_096056 Ga0466715_096056_14081_14938 285
109 3300042656 Ga0466732_240397 Ga0466732_240397_48_905 285
110 3300009784 Ga0123357_10373871 Ga0123357_103738711 286
111 3300042594 Ga0466694_406908 Ga0466694_406908_345_1205 286
112 3300042597 Ga0466699_259475 Ga0466699_259475_58_918 286
113 3300005071 Ga0068302_10108436 Ga0068302_101084361 287
114 3300042598 Ga0466701_040890 Ga0466701_040890_193_1056 287
115 iso_pr_bacteria 2590828803 2592928118 287
116 3300042606 Ga0466719_431957 Ga0466719_431957_7424_8293 289
117 iso_pr_bacteria 2940371297 2940372844 290
118 3300002462 JGI24702J35022_10044597 JGI24702J35022_100445973 292
119 3300042612 Ga0466705_346364 Ga0466705_346364_323_1201 292
120 3300042636 Ga0466703_042108 Ga0466703_042108_4022_4900 292
121 3300042643 Ga0466704_136764 Ga0466704_136764_5856_6734 292
122 3300042605 Ga0466716_319201 Ga0466716_319201_413_1300 295
123 3300042615 Ga0466711_019559 Ga0466711_019559_687_1574 295
124 3300042655 Ga0466727_197710 Ga0466727_197710_2267_3166 299
125 3300042599 Ga0466706_012634 Ga0466706_012634_46673_47575 300
126 3300042598 Ga0466701_081176 Ga0466701_081176_1984_2955 323
127 3300042609 Ga0466722_012183 Ga0466722_012183_1681_2658 325
128 3300042596 Ga0466696_162181 Ga0466696_162181_1048_2049 333

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.