Protein Family IF05154

Metagenome Isolate
110 Members
38 Samples
106 Scaffolds
202.74 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_137372|Ga0466696_137372_8417_9169
Length
250 aa
Sequence
MSLISPASDTDNHYRLDFLGVWRYNKNMAILIAHNKRRRKILEQAIDVFIKEGFENTTFQKIADNCNITRTTLYIYFKNKRELFSYSIKQLMNTVETDIISIKDDQSKNCIERLTLVFSIIIDRLVENRRLLSVVLEYLRYYAKNRKNTRETLAYGDKARRNASPEKKVHRRTIRIRHILAGIIIQGIGSGELPRNSVGYMGKLLYALLEAAVFRLTTLETASLEDLKQSARLMIYSQGKSPPPITQSTY

📊 Sample Types

Isolate 3.6%
Metagenome 96.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.8%
Termitidae 31.6%
Rhinotermitidae 10.5%
Unclassified 10.5%
Termopsidae 7.9%
Blaberidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 108
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
5 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
14 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
18 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
30 2772190975 Treponema sp. RmG30 Isolate Blaberidae
31 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
32 650716102 Treponema primitia ZAS-2 Isolate Unclassified
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
37 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10271910 3300010049 Bacteria 1785
2 Ga0466733_162319 3300042659 Bacteria 1329
3 Ga0466707_206217 3300042601 Bacteria 11154
4 Ga0466719_262776 3300042606 Bacteria 1124
5 Ga0466722_157908 3300042609 Bacteria 2393
6 Ga0466692_041378 3300042591 Bacteria 12137
7 Ga0466691_048064 3300042593 Bacteria 18994
8 Ga0466699_086189 3300042597 Bacteria 1463
9 Ga0466735_042689 3300042624 Bacteria 2979
10 Ga0466735_212666 3300042624 Bacteria 1334
11 Ga0466709_036321 3300042648 Bacteria 3747
12 Ga0466727_278021 3300042655 Bacteria 4277
13 Ga0466711_070174 3300042615 Bacteria 6673
14 Ga0466715_108485 3300042616 Unclassified 2168
15 Ga0466723_364348 3300042618 Bacteria 2218
16 Ga0123356_10557477 3300010049 Bacteria 1307
17 Ga0123353_10175027 3300010167 Bacteria 3403
18 Ga0123353_10383954 3300010167 Bacteria 2099
19 JGI24698J34947_10022851 3300002449 Bacteria 3349
20 JGI24695J34938_10040019 3300002450 Bacteria 2114
21 Ga0456237_0004986 3300041968 Bacteria 2117
22 Ga0466690_280755 3300042590 Bacteria 13189
23 Ga0466735_066371 3300042624 Bacteria 1480
24 Ga0466735_070543 3300042624 Bacteria 1387
25 Ga0466708_193754 3300042652 Bacteria 4316
26 Ga0466708_211670 3300042652 Bacteria 11257
27 Ga0466712_178525 3300042614 Bacteria 7423
28 Ga0466715_529520 3300042616 Bacteria 22075
29 Ga0466726_038504 3300042619 Bacteria 3026
30 JGI24698J34947_10008448 3300002449 Bacteria 5655
31 Ga0466707_359924 3300042601 Bacteria 1161
32 Ga0466705_268205 3300042612 Bacteria 7765
33 Ga0466703_089018 3300042636 Bacteria 23207
34 Ga0466703_144476 3300042636 Bacteria 21526
35 Ga0466727_305966 3300042655 Bacteria 1770
36 Ga0466715_132349 3300042616 Bacteria 19961
37 Ga0466715_188498 3300042616 Bacteria 1201
38 Ga0466723_206844 3300042618 Bacteria 4370
39 Ga0466728_187243 3300042620 Bacteria 3577
40 Ga0123353_10012960 3300010167 Bacteria 11907
41 Ga0123353_10097611 3300010167 Bacteria 4735
42 Ga0123353_10307408 3300010167 Bacteria 2416
43 Ga0466690_291041 3300042590 Bacteria 5301
44 Ga0466691_007169 3300042593 Bacteria 22555
45 Ga0466696_137372 3300042596 Bacteria 16678
46 Ga0466696_224571 3300042596 Bacteria 9854
47 Ga0466708_375225 3300042652 Bacteria 1937
48 Ga0466723_196766 3300042618 Bacteria 35787
49 Ga0466729_161040 3300042621 Bacteria 1447
50 Ga0123356_10322894 3300010049 Bacteria 1657
51 Ga0123353_11209948 3300010167 Bacteria 990
52 JGI24698J34947_10003085 3300002449 Bacteria 9019
53 Ga0466700_178297 3300042600 Bacteria 4862
54 Ga0466707_329521 3300042601 Bacteria 1053
55 Ga0466716_206628 3300042605 Bacteria 3720
56 Ga0466719_118224 3300042606 Bacteria 7537
57 Ga0466692_135951 3300042591 Bacteria 3336
58 Ga0466691_148396 3300042593 Bacteria 9423
59 Ga0466694_334980 3300042594 Bacteria 2199
60 Ga0466705_300481 3300042612 Bacteria 1724
61 Ga0466704_038379 3300042643 Unclassified 11318
62 Ga0466708_408079 3300042652 Bacteria 7867
63 Ga0466711_407909 3300042615 Bacteria 3893
64 Ga0466728_397884 3300042620 Bacteria 4431
65 Ga0123355_10246842 3300009826 Bacteria 2520
66 Ga0123353_10270361 3300010167 Bacteria 2619
67 Ga0123353_10863105 3300010167 Bacteria 1238
68 Ga0123354_10304417 3300010882 Bacteria 1501
69 JGI24698J34947_10026223 3300002449 Bacteria 3098
70 Ga0466707_278907 3300042601 Bacteria 1435
71 Ga0466707_372239 3300042601 Bacteria 1284
72 Ga0466694_207782 3300042594 Bacteria 3172
73 Ga0466696_131777 3300042596 Bacteria 5711
74 Ga0466705_277687 3300042612 Bacteria 15215
75 Ga0466708_386183 3300042652 Bacteria 15543
76 Ga0466708_448708 3300042652 Bacteria 1165
77 Ga0466715_036419 3300042616 Bacteria 4464
78 Ga0466726_229938 3300042619 Bacteria 1144
79 Ga0466728_246338 3300042620 Bacteria 15717
80 Ga0123355_10095171 3300009826 Bacteria 4709
81 JGI24698J34947_10032630 3300002449 Bacteria 2733
82 JGI24702J35022_10093882 3300002462 Bacteria 1636
83 Ga0466716_043475 3300042605 Bacteria 3563
84 Ga0466716_064362 3300042605 Bacteria 1703
85 Ga0466719_538576 3300042606 Bacteria 4280
86 Ga0466691_031582 3300042593 Bacteria 7816
87 Ga0466691_122234 3300042593 Bacteria 9111
88 Ga0466729_294352 3300042621 Bacteria 1094
89 Ga0466704_011596 3300042643 Bacteria 5512
90 Ga0466704_251748 3300042643 Bacteria 17542
91 Ga0466708_422285 3300042652 Bacteria 29586
92 Ga0466715_031858 3300042616 Bacteria 1262
93 Ga0466728_405246 3300042620 Bacteria 2212
94 Ga0466716_237285 3300042605 Bacteria 4020
95 Ga0466691_003546 3300042593 Bacteria 11140
96 Ga0466691_048177 3300042593 Bacteria 4127
97 Ga0466705_213408 3300042612 Bacteria 21536
98 Ga0466735_096479 3300042624 Bacteria 1686
99 Ga0466709_017463 3300042648 Bacteria 28555
100 Ga0466708_403346 3300042652 Bacteria 3224
101 Ga0466715_219956 3300042616 Bacteria 4940
102 Ga0466723_074812 3300042618 Bacteria 10325
103 Ga0466723_087714 3300042618 Bacteria 9855
104 Ga0466723_102255 3300042618 Bacteria 7020
105 Ga0466726_079319 3300042619 Bacteria 4476
106 Ga0466726_456839 3300042619 Bacteria 6910

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_372239 Ga0466707_372239_709_1236 175
2 3300042601 Ga0466707_329521 Ga0466707_329521_330_917 195
3 3300042619 Ga0466726_456839 Ga0466726_456839_1172_1759 195
4 3300042593 Ga0466691_031582 Ga0466691_031582_6370_6963 197
5 3300042593 Ga0466691_148396 Ga0466691_148396_2424_3017 197
6 3300042596 Ga0466696_131777 Ga0466696_131777_2131_2724 197
7 3300042605 Ga0466716_064362 Ga0466716_064362_750_1343 197
8 3300042606 Ga0466719_118224 Ga0466719_118224_4949_5542 197
9 3300042606 Ga0466719_262776 Ga0466719_262776_162_755 197
10 3300042614 Ga0466712_178525 Ga0466712_178525_2880_3473 197
11 3300042616 Ga0466715_132349 Ga0466715_132349_11959_12552 197
12 3300042616 Ga0466715_188498 Ga0466715_188498_467_1060 197
13 3300042618 Ga0466723_087714 Ga0466723_087714_8512_9105 197
14 3300042620 Ga0466728_246338 Ga0466728_246338_2818_3411 197
15 3300042620 Ga0466728_405246 Ga0466728_405246_1404_1997 197
16 3300042648 Ga0466709_017463 Ga0466709_017463_4370_4963 197
17 3300042652 Ga0466708_193754 Ga0466708_193754_392_985 197
18 3300042652 Ga0466708_422285 Ga0466708_422285_25149_25742 197
19 3300002449 JGI24698J34947_10003085 JGI24698J34947_100030853 198
20 3300002449 JGI24698J34947_10008448 JGI24698J34947_100084482 198
21 3300002449 JGI24698J34947_10032630 JGI24698J34947_100326302 198
22 3300042593 Ga0466691_003546 Ga0466691_003546_3656_4252 198
23 3300042593 Ga0466691_122234 Ga0466691_122234_1901_2497 198
24 3300042596 Ga0466696_224571 Ga0466696_224571_7950_8546 198
25 3300042606 Ga0466719_538576 Ga0466719_538576_1158_1754 198
26 3300042618 Ga0466723_074812 Ga0466723_074812_9611_10207 198
27 3300042618 Ga0466723_102255 Ga0466723_102255_2093_2689 198
28 3300042618 Ga0466723_196766 Ga0466723_196766_12962_13558 198
29 3300042621 Ga0466729_161040 Ga0466729_161040_660_1256 198
30 3300042624 Ga0466735_070543 Ga0466735_070543_539_1135 198
31 3300042624 Ga0466735_096479 Ga0466735_096479_726_1322 198
32 3300042624 Ga0466735_212666 Ga0466735_212666_203_799 198
33 3300042652 Ga0466708_403346 Ga0466708_403346_1998_2594 198
34 3300042652 Ga0466708_408079 Ga0466708_408079_6547_7143 198
35 iso_pr_bacteria 2781125653 2781313772 198
36 iso_pr_bacteria 650716102 650884121 198
37 3300009826 Ga0123355_10095171 Ga0123355_100951714 199
38 3300009826 Ga0123355_10246842 Ga0123355_102468423 199
39 3300010049 Ga0123356_10322894 Ga0123356_103228943 199
40 3300010049 Ga0123356_10557477 Ga0123356_105574772 199
41 3300010167 Ga0123353_10270361 Ga0123353_102703613 199
42 3300010882 Ga0123354_10304417 Ga0123354_103044172 199
43 3300042590 Ga0466690_291041 Ga0466690_291041_3715_4314 199
44 3300042591 Ga0466692_135951 Ga0466692_135951_2462_3061 199
45 3300042594 Ga0466694_334980 Ga0466694_334980_194_793 199
46 3300042619 Ga0466726_079319 Ga0466726_079319_94_693 199
47 3300042620 Ga0466728_187243 Ga0466728_187243_1701_2300 199
48 3300042620 Ga0466728_397884 Ga0466728_397884_3542_4141 199
49 3300042643 Ga0466704_251748 Ga0466704_251748_14811_15410 199
50 3300002449 JGI24698J34947_10026223 JGI24698J34947_100262233 200
51 3300010167 Ga0123353_10307408 Ga0123353_103074082 200
52 3300042591 Ga0466692_041378 Ga0466692_041378_5691_6293 200
53 3300042593 Ga0466691_048177 Ga0466691_048177_2646_3248 200
54 3300042594 Ga0466694_207782 Ga0466694_207782_34_636 200
55 3300042597 Ga0466699_086189 Ga0466699_086189_813_1415 200
56 3300042600 Ga0466700_178297 Ga0466700_178297_1193_1795 200
57 3300042601 Ga0466707_206217 Ga0466707_206217_4118_4720 200
58 3300042601 Ga0466707_278907 Ga0466707_278907_253_855 200
59 3300042605 Ga0466716_206628 Ga0466716_206628_2138_2740 200
60 3300042605 Ga0466716_237285 Ga0466716_237285_3073_3726 200
61 3300042615 Ga0466711_070174 Ga0466711_070174_2323_2925 200
62 3300042616 Ga0466715_108485 Ga0466715_108485_721_1323 200
63 3300042616 Ga0466715_529520 Ga0466715_529520_21029_21631 200
64 3300042624 Ga0466735_066371 Ga0466735_066371_102_704 200
65 3300042648 Ga0466709_036321 Ga0466709_036321_2774_3376 200
66 3300042652 Ga0466708_211670 Ga0466708_211670_8169_8771 200
67 3300002449 JGI24698J34947_10022851 JGI24698J34947_100228516 201
68 3300042601 Ga0466707_359924 Ga0466707_359924_239_844 201
69 3300042616 Ga0466715_036419 Ga0466715_036419_1123_1728 201
70 3300042618 Ga0466723_364348 Ga0466723_364348_1431_2036 201
71 3300042659 Ga0466733_162319 Ga0466733_162319_215_820 201
72 3300002450 JGI24695J34938_10040019 JGI24695J34938_100400193 202
73 3300010167 Ga0123353_10863105 Ga0123353_108631052 202
74 3300042612 Ga0466705_268205 Ga0466705_268205_1452_2060 202
75 3300042615 Ga0466711_407909 Ga0466711_407909_118_726 202
76 3300042621 Ga0466729_294352 Ga0466729_294352_262_870 202
77 3300042612 Ga0466705_213408 Ga0466705_213408_2840_3451 203
78 3300042616 Ga0466715_031858 Ga0466715_031858_538_1149 203
79 3300042643 Ga0466704_011596 Ga0466704_011596_966_1577 203
80 3300010167 Ga0123353_10012960 Ga0123353_100129603 204
81 3300041968 Ga0456237_0004986 Ga0456237_0004986_1437_2051 204
82 3300042618 Ga0466723_206844 Ga0466723_206844_1926_2540 204
83 iso_pr_bacteria 650716099 650877639 204
84 3300042609 Ga0466722_157908 Ga0466722_157908_1501_2118 205
85 3300042636 Ga0466703_089018 Ga0466703_089018_6839_7459 206
86 3300042619 Ga0466726_229938 Ga0466726_229938_28_651 207
87 3300042655 Ga0466727_278021 Ga0466727_278021_1757_2380 207
88 3300042655 Ga0466727_305966 Ga0466727_305966_1037_1660 207
89 3300010167 Ga0123353_10383954 Ga0123353_103839542 208
90 3300042605 Ga0466716_043475 Ga0466716_043475_2241_2867 208
91 3300042616 Ga0466715_219956 Ga0466715_219956_3835_4461 208
92 3300042652 Ga0466708_448708 Ga0466708_448708_316_945 209
93 3300010049 Ga0123356_10271910 Ga0123356_102719102 210
94 3300010167 Ga0123353_10097611 Ga0123353_100976114 210
95 3300042619 Ga0466726_038504 Ga0466726_038504_2340_2972 210
96 3300042624 Ga0466735_042689 Ga0466735_042689_414_1046 210
97 iso_pr_bacteria 2772190975 2773721014 211
98 3300010167 Ga0123353_10175027 Ga0123353_101750272 212
99 3300010167 Ga0123353_11209948 Ga0123353_112099482 212
100 3300042593 Ga0466691_048064 Ga0466691_048064_2849_3487 212
101 3300002462 JGI24702J35022_10093882 JGI24702J35022_100938821 214
102 3300042652 Ga0466708_386183 Ga0466708_386183_13025_13681 218
103 3300042612 Ga0466705_277687 Ga0466705_277687_14392_15054 220
104 3300042612 Ga0466705_300481 Ga0466705_300481_901_1563 220
105 3300042643 Ga0466704_038379 Ga0466704_038379_7526_8188 220
106 3300042636 Ga0466703_144476 Ga0466703_144476_19985_20650 221
107 3300042590 Ga0466690_280755 Ga0466690_280755_2775_3446 223
108 3300042593 Ga0466691_007169 Ga0466691_007169_10346_11017 223
109 3300042652 Ga0466708_375225 Ga0466708_375225_62_751 229
110 3300042596 Ga0466696_137372 Ga0466696_137372_8417_9169 250

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00440 TetR_N Bacterial regulatory proteins, tetR family 41 84 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00440 GO:0003677 DNA binding MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
5gpa-assembly1.cif.gz_A Structural analysis of fatty acid degradation regulator FadR from Bacillus halodurans 0.846 37 235
3vpr-assembly2.cif.gz_C Crystal Structure of a TetR Family Transcriptional Regulator PfmR from Thermus thermophilus HB8 0.83 41 235
5gpc-assembly1.cif.gz_B Structural analysis of fatty acid degradation regulator FadR from Bacillus halodurans 0.826 37 235
3vpr-assembly2.cif.gz_D Crystal Structure of a TetR Family Transcriptional Regulator PfmR from Thermus thermophilus HB8 0.821 41 235
3crj-assembly1.cif.gz_B Crystal structure of a TetR transcription regulator from Haloarcula marismortui ATCC 43049 0.812 35 240
IDDescriptionScoreStartEndSuperfamily
5k7fA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9597 38 77 1.10.10.60
3whcE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9555 35 79 1.10.10.60
5gpaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9541 37 79 1.10.10.60
2ibdB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9499 38 77 1.10.10.60
4w1uA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9491 37 77 1.10.10.60
IDDescriptionScoreStartEndGO Terms
AF-A0A5C1QDZ5-F1-model_v4 Uncharacterized/unreviewed 0.8773 34 241 GO:0003677

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.