Protein Family IF05149

Metagenome Isolate
151 Members
44 Samples
149 Scaffolds
417.6 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_129657|Ga0466696_129657_8442_9914
Length
490 aa
Sequence
LRQLQPTGYYKFHVPPFSFAPGLLLSPGFFCGCSKIRRFWAAALVYLTFFVYNNGGGETIVAFIRASSEVFMAEEQRDFKSIIQLDSELNQIQDLDLLLERILFEARKVVHADAGSIYVKEKCAEEGGKQVEKLVIKYAQNDTTQKELPPGQKMIYSVFSVPIDEKTISGYCAFTKNLVNIPDAYAIPPDAPYSFGDRYDKISGYRTTSVLAIPLVASEGRLLGVIQVINSKGRDGNTVPFSADDELLFTHFAANAAAALERAYITRAMILRMIKMSELRDPKETGSHVNRVAGYAVEIYDRWAYHHHVAKTEQEKFRDDLKIAAMLHDVGKVAISDVILKKPGRFTPGEYLIMQHHTIYGAALFDDPQSALDLIARDIALTHHENWDGTGYPGWIDPLTQEPIRAGENGKALGRKGEEIPLGGRIVAIADVFDALCSRRVYKEPWSEEQVLAEIRQLSDTKFDPDLVDIFFEILPSIKQIQSLYPEAAD

📊 Sample Types

Isolate 1.3%
Metagenome 98.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.6%
Kalotermitidae 33.3%
Unclassified 7.1%
Termopsidae 7.1%
Rhinotermitidae 4.8%

🌳 Taxonomy

Archaea 0
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
20 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
21 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
25 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
26 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
27 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
35 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
38 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_059440 3300042612 Bacteria 5691
2 Ga0466732_358076 3300042656 Bacteria 7658
3 Ga0466719_517871 3300042606 Bacteria 2071
4 Ga0466720_092544 3300042607 Bacteria 4222
5 Ga0466722_017754 3300042609 Bacteria 1841
6 Ga0466711_038798 3300042615 Bacteria 2136
7 Ga0466711_236469 3300042615 Bacteria 97130
8 Ga0466718_169275 3300042617 Bacteria 2621
9 Ga0466726_177957 3300042619 Bacteria 16745
10 Ga0466728_086949 3300042620 Bacteria 7629
11 JGI24698J34947_10014460 3300002449 Bacteria 4298
12 JGI24698J34947_10019462 3300002449 Bacteria 3661
13 JGI24698J34947_10029413 3300002449 Bacteria 2902
14 JGI24695J34938_10000439 3300002450 Bacteria 40122
15 Ga0072941_1003013 3300005201 Bacteria 3374
16 Ga0072941_1009356 3300005201 Bacteria 21774
17 Ga0264413_119237 3300024493 Bacteria 6757
18 Ga0466691_030135 3300042593 Bacteria 5145
19 Ga0466691_145435 3300042593 Bacteria 3694
20 Ga0466694_129434 3300042594 Bacteria 2375
21 Ga0466696_115940 3300042596 Bacteria 3308
22 Ga0466696_139953 3300042596 Bacteria 11511
23 Ga0466703_320231 3300042636 Bacteria 76119
24 Ga0466704_096061 3300042643 Bacteria 1989
25 Ga0466709_055183 3300042648 Bacteria 6463
26 Ga0466709_069892 3300042648 Bacteria 2119
27 Ga0466709_353607 3300042648 Bacteria 5656
28 Ga0466705_216081 3300042612 Bacteria 5107
29 Ga0466705_267853 3300042612 Bacteria 2529
30 Ga0466700_181713 3300042600 Bacteria 63326
31 Ga0466719_041739 3300042606 Bacteria 6726
32 Ga0466720_122048 3300042607 Unclassified 2415
33 Ga0466726_235901 3300042619 Bacteria 2664
34 Ga0466728_196724 3300042620 Bacteria 10642
35 JGI24698J34947_10026222 3300002449 Bacteria 3098
36 JGI24698J34947_10075346 3300002449 Bacteria 1604
37 Ga0072941_1053271 3300005201 Bacteria 5687
38 Ga0264413_108521 3300024493 Bacteria 12180
39 Ga0466690_253383 3300042590 Bacteria 3775
40 Ga0466692_058159 3300042591 Bacteria 2220
41 Ga0466696_288483 3300042596 Bacteria 26421
42 Ga0466704_168830 3300042643 Bacteria 7731
43 Ga0466709_257902 3300042648 Bacteria 5857
44 Ga0466708_097904 3300042652 Bacteria 41312
45 Ga0466708_230165 3300042652 Bacteria 4482
46 Ga0466727_345077 3300042655 Bacteria 5699
47 Ga0466705_187250 3300042612 Bacteria 6494
48 Ga0466705_333827 3300042612 Bacteria 9487
49 Ga0466707_315228 3300042601 Bacteria 1416
50 Ga0466707_375637 3300042601 Bacteria 2161
51 Ga0466728_125878 3300042620 Bacteria 24281
52 Ga0466728_128508 3300042620 Bacteria 10324
53 Ga0466728_397204 3300042620 Bacteria 5593
54 JGI24698J34947_10008872 3300002449 Bacteria 5519
55 Ga0415639_037634 3300038395 Bacteria 4888
56 Ga0466694_012435 3300042594 Bacteria 9660
57 Ga0466695_253971 3300042595 Bacteria 30792
58 Ga0466695_321049 3300042595 Bacteria 1565
59 Ga0466696_259712 3300042596 Bacteria 29051
60 Ga0466731_012393 3300042622 Bacteria 11846
61 Ga0466703_150660 3300042636 Bacteria 17387
62 Ga0466703_193614 3300042636 Bacteria 8057
63 Ga0466704_175805 3300042643 Bacteria 2906
64 Ga0466704_324557 3300042643 Bacteria 2434
65 Ga0466709_376473 3300042648 Bacteria 1703
66 Ga0466733_094176 3300042659 Bacteria 8921
67 Ga0466717_184615 3300042604 Bacteria 1319
68 Ga0466716_090361 3300042605 Bacteria 12811
69 Ga0466720_065230 3300042607 Bacteria 3992
70 Ga0466712_056070 3300042614 Bacteria 8391
71 Ga0466712_066563 3300042614 Bacteria 10732
72 JGI24698J34947_10005060 3300002449 Bacteria 7223
73 JGI24698J34947_10027483 3300002449 Bacteria 3018
74 JGI24695J34938_10003105 3300002450 Bacteria 11870
75 JGI24702J35022_10002824 3300002462 Bacteria 10527
76 Ga0264413_110914 3300024493 Bacteria 4251
77 Ga0466691_005244 3300042593 Bacteria 8739
78 Ga0466691_059914 3300042593 Bacteria 14735
79 Ga0466691_132757 3300042593 Bacteria 16814
80 Ga0466694_049035 3300042594 Bacteria 10888
81 Ga0466696_105780 3300042596 Bacteria 1985
82 Ga0466699_301575 3300042597 Bacteria 8866
83 Ga0466704_083910 3300042643 Bacteria 12895
84 Ga0466705_134074 3300042612 Bacteria 5593
85 Ga0466716_429805 3300042605 Bacteria 2866
86 Ga0466722_202911 3300042609 Bacteria 11614
87 Ga0466712_028612 3300042614 Bacteria 1604
88 Ga0466712_097212 3300042614 Bacteria 1488
89 Ga0466712_280069 3300042614 Bacteria 3829
90 Ga0466715_260247 3300042616 Bacteria 3886
91 Ga0466715_534972 3300042616 Bacteria 7927
92 Ga0466723_195628 3300042618 Bacteria 1505
93 Ga0466723_351422 3300042618 Bacteria 7967
94 AustNasuHG_c1005269 3300000089 Bacteria 4619
95 AustNasuHG_c1010986 3300000089 Bacteria 3144
96 Ga0466692_130857 3300042591 Bacteria 4190
97 Ga0466693_358367 3300042592 Bacteria 2076
98 Ga0466694_333351 3300042594 Bacteria 5028
99 Ga0466696_162868 3300042596 Bacteria 4789
100 Ga0466708_112910 3300042652 Bacteria 7205
101 Ga0466708_264139 3300042652 Bacteria 1738
102 Ga0466717_192575 3300042604 Bacteria 1567
103 Ga0466719_063712 3300042606 Bacteria 26562
104 Ga0466722_142566 3300042609 Bacteria 4316
105 Ga0466705_482804 3300042612 Bacteria 6735
106 Ga0466712_149029 3300042614 Bacteria 5422
107 Ga0466715_226168 3300042616 Bacteria 12316
108 Ga0466715_244472 3300042616 Bacteria 3467
109 Ga0466718_168955 3300042617 Bacteria 2619
110 Ga0466723_202414 3300042618 Bacteria 6084
111 AustNasuHG_c1006050 3300000089 Bacteria 4322
112 JGI24698J34947_10003186 3300002449 Bacteria 8890
113 JGI24698J34947_10012748 3300002449 Bacteria 4600
114 JGI24698J34947_10027076 3300002449 Bacteria 3043
115 JGI24698J34947_10050381 3300002449 Bacteria 2101
116 JGI24698J34947_10067400 3300002449 Bacteria 1737
117 Ga0466691_033582 3300042593 Bacteria 1685
118 Ga0123356_10020555 3300010049 Bacteria 6245
119 Ga0466702_151796 3300042635 Bacteria 28798
120 Ga0466720_083377 3300042607 Bacteria 2988
121 Ga0466705_411325 3300042612 Bacteria 6453
122 Ga0466705_502706 3300042612 Bacteria 1535
123 Ga0466723_150950 3300042618 Bacteria 119524
124 Ga0466728_107104 3300042620 Bacteria 10380
125 JGI24698J34947_10023691 3300002449 Bacteria 3284
126 Ga0466690_205956 3300042590 Bacteria 8251
127 Ga0466691_010662 3300042593 Bacteria 3847
128 Ga0466694_269553 3300042594 Bacteria 2785
129 Ga0466696_129657 3300042596 Bacteria 12080
130 Ga0123353_10007410 3300010167 Bacteria 14815
131 Ga0466735_085284 3300042624 Bacteria 1940
132 Ga0466702_392427 3300042635 Bacteria 3205
133 Ga0466703_043532 3300042636 Bacteria 16956
134 Ga0466704_251320 3300042643 Bacteria 235343
135 Ga0466719_010708 3300042606 Bacteria 4397
136 Ga0466722_260200 3300042609 Bacteria 11199
137 Ga0466712_180668 3300042614 Bacteria 4732
138 Ga0466711_062549 3300042615 Bacteria 3254
139 Ga0466711_484605 3300042615 Bacteria 2418
140 Ga0466728_045066 3300042620 Bacteria 7214
141 Ga0466728_227990 3300042620 Bacteria 2942
142 Ga0466699_149738 3300042597 Bacteria 9645
143 Ga0466699_403371 3300042597 Bacteria 10189
144 Ga0123353_10120015 3300010167 Bacteria 4228
145 Ga0466704_333334 3300042643 Bacteria 2245
146 Ga0466704_422311 3300042643 Unclassified 7391
147 Ga0466704_540314 3300042643 Bacteria 3811
148 Ga0466709_349037 3300042648 Bacteria 3710
149 Ga0466708_288804 3300042652 Bacteria 20693

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_259712 Ga0466696_259712_3907_5103 398
2 3300010167 Ga0123353_10120015 Ga0123353_101200156 402
3 3300042656 Ga0466732_358076 Ga0466732_358076_4052_5263 403
4 3300042591 Ga0466692_058159 Ga0466692_058159_632_1885 404
5 3300042609 Ga0466722_017754 Ga0466722_017754_495_1709 404
6 3300042643 Ga0466704_540314 Ga0466704_540314_1055_2269 404
7 3300042624 Ga0466735_085284 Ga0466735_085284_513_1766 405
8 3300042607 Ga0466720_092544 Ga0466720_092544_1737_2999 410
9 3300042614 Ga0466712_280069 Ga0466712_280069_538_1791 411
10 3300042619 Ga0466726_177957 Ga0466726_177957_12807_14042 411
11 3300002450 JGI24695J34938_10003105 JGI24695J34938_100031054 413
12 3300042596 Ga0466696_105780 Ga0466696_105780_422_1663 413
13 3300042594 Ga0466694_269553 Ga0466694_269553_1479_2723 414
14 3300042594 Ga0466694_333351 Ga0466694_333351_3385_4629 414
15 3300042618 Ga0466723_150950 Ga0466723_150950_81838_83082 414
16 iso_pr_bacteria 2781125692 2781430501 414
17 3300042594 Ga0466694_012435 Ga0466694_012435_3520_4767 415
18 3300042596 Ga0466696_139953 Ga0466696_139953_4209_5456 415
19 3300042601 Ga0466707_375637 Ga0466707_375637_766_2013 415
20 3300042604 Ga0466717_192575 Ga0466717_192575_153_1400 415
21 3300042612 Ga0466705_216081 Ga0466705_216081_151_1398 415
22 3300042614 Ga0466712_066563 Ga0466712_066563_1501_2748 415
23 3300042617 Ga0466718_168955 Ga0466718_168955_1220_2467 415
24 3300042617 Ga0466718_169275 Ga0466718_169275_1220_2467 415
25 3300042635 Ga0466702_151796 Ga0466702_151796_6464_7711 415
26 3300042635 Ga0466702_392427 Ga0466702_392427_1788_3035 415
27 3300042659 Ga0466733_094176 Ga0466733_094176_3683_4930 415
28 3300002449 JGI24698J34947_10008872 JGI24698J34947_100088724 416
29 3300002449 JGI24698J34947_10029413 JGI24698J34947_100294132 416
30 3300002449 JGI24698J34947_10050381 JGI24698J34947_100503812 416
31 3300010049 Ga0123356_10020555 Ga0123356_100205555 416
32 3300042593 Ga0466691_005244 Ga0466691_005244_7446_8696 416
33 3300042597 Ga0466699_149738 Ga0466699_149738_7243_8493 416
34 3300042597 Ga0466699_301575 Ga0466699_301575_6004_7254 416
35 3300042597 Ga0466699_403371 Ga0466699_403371_2961_4211 416
36 3300042600 Ga0466700_181713 Ga0466700_181713_40482_41732 416
37 3300042606 Ga0466719_517871 Ga0466719_517871_585_1835 416
38 3300042609 Ga0466722_202911 Ga0466722_202911_4502_5752 416
39 3300042609 Ga0466722_260200 Ga0466722_260200_127_1377 416
40 3300042612 Ga0466705_134074 Ga0466705_134074_473_1723 416
41 3300042614 Ga0466712_056070 Ga0466712_056070_6589_7839 416
42 3300042614 Ga0466712_097212 Ga0466712_097212_28_1278 416
43 3300042615 Ga0466711_038798 Ga0466711_038798_706_1956 416
44 3300042615 Ga0466711_484605 Ga0466711_484605_218_1468 416
45 3300042616 Ga0466715_244472 Ga0466715_244472_565_1815 416
46 3300042636 Ga0466703_150660 Ga0466703_150660_14788_16038 416
47 3300042648 Ga0466709_055183 Ga0466709_055183_3298_4548 416
48 3300042648 Ga0466709_353607 Ga0466709_353607_300_1550 416
49 3300042652 Ga0466708_264139 Ga0466708_264139_184_1434 416
50 iso_pr_bacteria 2781125644 2781296204 416
51 3300000089 AustNasuHG_c1006050 AustNasuHG_10060506 417
52 3300002449 JGI24698J34947_10012748 JGI24698J34947_100127484 417
53 3300002449 JGI24698J34947_10014460 JGI24698J34947_100144603 417
54 3300002449 JGI24698J34947_10026222 JGI24698J34947_100262223 417
55 3300002449 JGI24698J34947_10027076 JGI24698J34947_100270763 417
56 3300002449 JGI24698J34947_10027483 JGI24698J34947_100274832 417
57 3300002449 JGI24698J34947_10067400 JGI24698J34947_100674001 417
58 3300002449 JGI24698J34947_10075346 JGI24698J34947_100753462 417
59 3300002450 JGI24695J34938_10000439 JGI24695J34938_1000043929 417
60 3300005201 Ga0072941_1003013 Ga0072941_10030131 417
61 3300005201 Ga0072941_1009356 Ga0072941_100935622 417
62 3300005201 Ga0072941_1053271 Ga0072941_10532714 417
63 3300024493 Ga0264413_108521 Ga0264413_1085217 417
64 3300024493 Ga0264413_110914 Ga0264413_1109142 417
65 3300042592 Ga0466693_358367 Ga0466693_358367_215_1468 417
66 3300042594 Ga0466694_049035 Ga0466694_049035_6474_7727 417
67 3300042596 Ga0466696_115940 Ga0466696_115940_1674_2927 417
68 3300042604 Ga0466717_184615 Ga0466717_184615_26_1279 417
69 3300042607 Ga0466720_065230 Ga0466720_065230_386_1639 417
70 3300042607 Ga0466720_083377 Ga0466720_083377_436_1689 417
71 3300042607 Ga0466720_122048 Ga0466720_122048_726_1979 417
72 3300042609 Ga0466722_142566 Ga0466722_142566_249_1502 417
73 3300042612 Ga0466705_267853 Ga0466705_267853_1107_2360 417
74 3300042614 Ga0466712_028612 Ga0466712_028612_245_1498 417
75 3300042615 Ga0466711_236469 Ga0466711_236469_40208_41461 417
76 3300042643 Ga0466704_168830 Ga0466704_168830_1149_2402 417
77 3300042655 Ga0466727_345077 Ga0466727_345077_539_1792 417
78 3300002449 JGI24698J34947_10023691 JGI24698J34947_100236913 418
79 3300038395 Ga0415639_037634 Ga0415639_037634_449_1705 418
80 3300042590 Ga0466690_205956 Ga0466690_205956_3924_5180 418
81 3300042593 Ga0466691_010662 Ga0466691_010662_1819_3075 418
82 3300042593 Ga0466691_033582 Ga0466691_033582_73_1329 418
83 3300042593 Ga0466691_059914 Ga0466691_059914_8460_9716 418
84 3300042593 Ga0466691_132757 Ga0466691_132757_6081_7337 418
85 3300042593 Ga0466691_145435 Ga0466691_145435_1198_2454 418
86 3300042595 Ga0466695_321049 Ga0466695_321049_266_1522 418
87 3300042605 Ga0466716_429805 Ga0466716_429805_1534_2790 418
88 3300042606 Ga0466719_010708 Ga0466719_010708_2357_3613 418
89 3300042606 Ga0466719_041739 Ga0466719_041739_827_2083 418
90 3300042612 Ga0466705_333827 Ga0466705_333827_787_2043 418
91 3300042612 Ga0466705_411325 Ga0466705_411325_1196_2452 418
92 3300042612 Ga0466705_502706 Ga0466705_502706_22_1278 418
93 3300042614 Ga0466712_149029 Ga0466712_149029_1244_2500 418
94 3300042616 Ga0466715_226168 Ga0466715_226168_4007_5263 418
95 3300042616 Ga0466715_534972 Ga0466715_534972_5140_6396 418
96 3300042618 Ga0466723_195628 Ga0466723_195628_133_1389 418
97 3300042618 Ga0466723_202414 Ga0466723_202414_828_2084 418
98 3300042620 Ga0466728_045066 Ga0466728_045066_3233_4489 418
99 3300042620 Ga0466728_086949 Ga0466728_086949_4139_5395 418
100 3300042620 Ga0466728_128508 Ga0466728_128508_3410_4666 418
101 3300042620 Ga0466728_397204 Ga0466728_397204_2811_4067 418
102 3300042636 Ga0466703_043532 Ga0466703_043532_10822_12078 418
103 3300042636 Ga0466703_193614 Ga0466703_193614_2543_3799 418
104 3300042643 Ga0466704_083910 Ga0466704_083910_158_1414 418
105 3300042643 Ga0466704_096061 Ga0466704_096061_595_1851 418
106 3300042643 Ga0466704_251320 Ga0466704_251320_53727_54983 418
107 3300042643 Ga0466704_422311 Ga0466704_422311_3797_5053 418
108 3300042648 Ga0466709_069892 Ga0466709_069892_738_1994 418
109 3300042652 Ga0466708_112910 Ga0466708_112910_1151_2407 418
110 3300000089 AustNasuHG_c1010986 AustNasuHG_10109862 419
111 3300002449 JGI24698J34947_10003186 JGI24698J34947_100031864 419
112 3300042596 Ga0466696_288483 Ga0466696_288483_20953_22212 419
113 3300042601 Ga0466707_315228 Ga0466707_315228_36_1295 419
114 3300042612 Ga0466705_187250 Ga0466705_187250_1201_2460 419
115 3300042614 Ga0466712_180668 Ga0466712_180668_89_1348 419
116 3300042615 Ga0466711_062549 Ga0466711_062549_1837_3096 419
117 3300042618 Ga0466723_351422 Ga0466723_351422_5412_6671 419
118 3300042620 Ga0466728_107104 Ga0466728_107104_7054_8313 419
119 3300042643 Ga0466704_175805 Ga0466704_175805_1069_2328 419
120 3300042643 Ga0466704_333334 Ga0466704_333334_510_1769 419
121 3300042652 Ga0466708_288804 Ga0466708_288804_5176_6435 419
122 3300000089 AustNasuHG_c1005269 AustNasuHG_10052694 420
123 3300002449 JGI24698J34947_10005060 JGI24698J34947_100050604 420
124 3300002449 JGI24698J34947_10019462 JGI24698J34947_100194623 420
125 3300010167 Ga0123353_10007410 Ga0123353_1000741019 420
126 3300042590 Ga0466690_253383 Ga0466690_253383_2150_3412 420
127 3300042594 Ga0466694_129434 Ga0466694_129434_904_2166 420
128 3300042596 Ga0466696_162868 Ga0466696_162868_1230_2492 420
129 3300042612 Ga0466705_482804 Ga0466705_482804_117_1379 420
130 3300042616 Ga0466715_260247 Ga0466715_260247_235_1497 420
131 3300042620 Ga0466728_196724 Ga0466728_196724_7619_8881 420
132 3300042620 Ga0466728_227990 Ga0466728_227990_336_1598 420
133 3300042636 Ga0466703_320231 Ga0466703_320231_60688_61950 420
134 3300042648 Ga0466709_257902 Ga0466709_257902_4524_5786 420
135 3300042652 Ga0466708_230165 Ga0466708_230165_2558_3844 420
136 3300024493 Ga0264413_119237 Ga0264413_1192375 421
137 3300042593 Ga0466691_030135 Ga0466691_030135_3799_5064 421
138 3300042605 Ga0466716_090361 Ga0466716_090361_6811_8076 421
139 3300042606 Ga0466719_063712 Ga0466719_063712_16961_18226 421
140 3300042620 Ga0466728_125878 Ga0466728_125878_18202_19467 421
141 3300042648 Ga0466709_376473 Ga0466709_376473_151_1416 421
142 3300042652 Ga0466708_097904 Ga0466708_097904_28218_29483 421
143 3300042643 Ga0466704_324557 Ga0466704_324557_695_1963 422
144 3300042591 Ga0466692_130857 Ga0466692_130857_2649_3920 423
145 3300042622 Ga0466731_012393 Ga0466731_012393_1479_2750 423
146 3300002462 JGI24702J35022_10002824 JGI24702J35022_100028243 425
147 3300042648 Ga0466709_349037 Ga0466709_349037_347_1624 425
148 3300042612 Ga0466705_059440 Ga0466705_059440_2691_3974 427
149 3300042595 Ga0466695_253971 Ga0466695_253971_4093_5388 431
150 3300042619 Ga0466726_235901 Ga0466726_235901_1159_2466 435
151 3300042596 Ga0466696_129657 Ga0466696_129657_8442_9914 490

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13487 HD_5 HD domain 410 467 0.94
PF01966 HD HD domain 286 435 0.93
PF01590 GAF GAF domain 94 260 0.81
PF13492 GAF_3 GAF domain 95 262 0.71
PF13185 GAF_2 GAF domain 93 261 0.66

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01590 GO:0005515 protein binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.59 0.65 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.