Protein Family IF05147

Metagenome Isolate
186 Members
59 Samples
180 Scaffolds
142.74 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_124454|Ga0466696_124454_11288_11770
Length
160 aa
Sequence
LTGKSKRTTIMTIQEIQQQIADEFSVFTEWLDKYAYLIELGKSLTPYDEKNRVEQNLIQGCQSRVWLNAELTDDGKLAFTADSDAIITKGIVSLLVRVFSGQTPQDIIAADVSFLDKIGLRENLSPTRANGLLSMVKQMKLYAVAFDAQKRNPQPVNSPN

πŸ“Š Sample Types

Isolate 3.2%
Metagenome 96.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 41.4%
Kalotermitidae 24.1%
Unclassified 12.1%
Termopsidae 5.2%
Rhinotermitidae 5.2%
Passalidae 3.4%
Blattidae 3.4%
Armadillidiidae 1.7%
Hodotermitidae 1.7%
Formicidae 1.7%

🌳 Taxonomy

Archaea 1
Bacteria 177
Eukaryota 0
Viruses 1
Unclassified 7

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
4 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
21 2920168565 Paludibacter sp. 221 Isolate Blattidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
36 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
48 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
49 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
51 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
52 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
53 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
54 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
55 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
56 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
57 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_134431 3300042656 Bacteria 1014
2 Ga0466733_021781 3300042659 Bacteria 2130
3 Ga0466704_445202 3300042643 Bacteria 2743
4 Ga0466690_231717 3300042590 Bacteria 10279
5 Ga0466690_418022 3300042590 Bacteria 18447
6 Ga0466691_119991 3300042593 Bacteria 41422
7 Ga0466696_022111 3300042596 Bacteria 3010
8 Ga0466696_075613 3300042596 Bacteria 2562
9 Ga0123356_10051107 3300010049 Bacteria 3845
10 Ga0123356_11405145 3300010049 Bacteria 858
11 Ga0123353_10072870 3300010167 Bacteria 5520
12 Ga0123353_10863347 3300010167 Bacteria 1238
13 Ga0123354_10093161 3300010882 Bacteria 4143
14 Ga0466712_320872 3300042614 Bacteria 1414
15 Ga0466711_126881 3300042615 Bacteria 7656
16 Ga0466718_112585 3300042617 Bacteria 2635
17 Ga0466723_031620 3300042618 Bacteria 46972
18 Ga0466726_447449 3300042619 Bacteria 3062
19 Ga0466728_332643 3300042620 Bacteria 3872
20 Ga0466701_099379 3300042598 Bacteria 1156
21 Ga0466719_386651 3300042606 Unclassified 1691
22 Ga0466698_045407 3300042610 Bacteria 1385
23 IMNBL1DRAFT_c0054762 3300000062 Bacteria 1234
24 Ga0466705_012668 3300042612 Bacteria 2906
25 Ga0466732_190481 3300042656 Bacteria 1066
26 Ga0466732_332718 3300042656 Bacteria 1819
27 Ga0466703_104748 3300042636 Bacteria 7412
28 Ga0466709_127340 3300042648 Bacteria 4907
29 Ga0466725_198449 3300042654 Bacteria 2353
30 Ga0466696_124454 3300042596 Bacteria 17331
31 Ga0466696_128027 3300042596 Bacteria 5216
32 Ga0466696_427206 3300042596 Bacteria 4179
33 Ga0123353_10000053 3300010167 Bacteria 130089
34 Ga0123354_10131627 3300010882 Bacteria 3156
35 Ga0466729_114770 3300042621 Bacteria 12196
36 Ga0466716_061134 3300042605 Bacteria 7887
37 Ga0466719_125870 3300042606 Bacteria 1967
38 Ga0466722_250232 3300042609 Bacteria 10293
39 Ga0466698_270872 3300042610 Bacteria 3164
40 IMNBL1DRAFT_c0009034 3300000062 Bacteria 4995
41 Ga0072940_1158086 3300005200 Bacteria 955
42 Ga0466705_043701 3300042612 Bacteria 1345
43 Ga0466705_370133 3300042612 Bacteria 27217
44 Ga0466727_274524 3300042655 Bacteria 16423
45 Ga0466657_199242 3300042582 Bacteria 2252
46 Ga0466691_091910 3300042593 Bacteria 7343
47 Ga0123353_10069440 3300010167 Bacteria 5660
48 Ga0123353_10303281 3300010167 Bacteria 2436
49 Ga0466712_092176 3300042614 Bacteria 3022
50 Ga0466728_228281 3300042620 Bacteria 35456
51 Ga0466706_024744 3300042599 Bacteria 35584
52 Ga0466706_059465 3300042599 Bacteria 3553
53 Ga0466706_211053 3300042599 Bacteria 122086
54 Ga0466707_173327 3300042601 Bacteria 10833
55 Ga0466714_027987 3300042603 Bacteria 18048
56 Ga0466714_077188 3300042603 Bacteria 1742
57 Ga0466719_244456 3300042606 Bacteria 1641
58 Ga0466722_126917 3300042609 Bacteria 2073
59 IMNBL1DRAFT_c0002486 3300000062 Bacteria 12788
60 Ga0068302_10261506 3300005071 Bacteria 2602
61 Ga0072940_1103344 3300005200 Bacteria 1477
62 Ga0072941_1066306 3300005201 Bacteria 4462
63 Ga0466733_006487 3300042659 Bacteria 1690
64 Ga0466733_051789 3300042659 Bacteria 3525
65 Ga0466733_167667 3300042659 Bacteria 1644
66 Ga0466704_062076 3300042643 Bacteria 6235
67 Ga0466708_264419 3300042652 Bacteria 49465
68 Ga0466657_068092 3300042582 Bacteria 157899
69 Ga0466691_124547 3300042593 Bacteria 6182
70 Ga0466699_400731 3300042597 Bacteria 1814
71 Ga0123356_10728025 3300010049 Bacteria 1162
72 Ga0123356_11590634 3300010049 Bacteria 809
73 Ga0123356_12792473 3300010049 Bacteria 611
74 Ga0466715_117071 3300042616 Bacteria 2782
75 Ga0466718_047477 3300042617 Bacteria 1670
76 Ga0466726_055493 3300042619 Bacteria 2775
77 Ga0466729_094959 3300042621 Bacteria 7754
78 Ga0466729_099720 3300042621 Bacteria 12798
79 Ga0466713_063972 3300042602 Bacteria 1410
80 Ga0466714_047059 3300042603 Bacteria 5742
81 Ga0466714_098344 3300042603 Bacteria 4380
82 Ga0466717_103287 3300042604 Bacteria 1232
83 Ga0466719_572480 3300042606 Bacteria 3638
84 IMNBL1DRAFT_c0007092 3300000062 Bacteria 5963
85 JGI24702J35022_10038705 3300002462 Bacteria 2546
86 JGI24705J35276_12222574 3300002504 Unclassified 2432
87 JGI24705J35276_12236276 3300002504 Bacteria 7763
88 Ga0072940_1158085 3300005200 Bacteria 1497
89 Ga0466697_065449 3300042611 Bacteria 1648
90 Ga0466705_220469 3300042612 Unclassified 1359
91 Ga0466732_156352 3300042656 Bacteria 5352
92 Ga0466731_012581 3300042622 Bacteria 1612
93 Ga0466690_024191 3300042590 Bacteria 8374
94 Ga0466690_090562 3300042590 Bacteria 8703
95 Ga0123355_10001369 3300009826 Bacteria 33944
96 Ga0123356_13025322 3300010049 Bacteria 587
97 Ga0123353_10351648 3300010167 Bacteria 2220
98 Ga0123353_10746431 3300010167 Bacteria 1363
99 Ga0123353_11354008 3300010167 Bacteria 919
100 Ga0123353_12635477 3300010167 Unclassified 594
101 Ga0466715_173123 3300042616 Bacteria 2746
102 Ga0466715_506549 3300042616 Bacteria 7737
103 Ga0466723_138623 3300042618 Bacteria 14320
104 Ga0466728_104727 3300042620 Bacteria 10439
105 Ga0466706_225176 3300042599 Bacteria 38857
106 Ga0466707_000364 3300042601 Bacteria 1306
107 Ga0466714_133436 3300042603 Bacteria 2205
108 Ga0466716_437183 3300042605 Bacteria 31064
109 Ga0466716_520514 3300042605 Bacteria 6887
110 Ga0466698_002753 3300042610 Bacteria 2570
111 2227601850 2225789004 Bacteria 2330
112 Ga0068305_10042196 3300005083 Bacteria 15988
113 Ga0466697_066086 3300042611 Bacteria 1060
114 Ga0466732_394096 3300042656 Bacteria 12185
115 Ga0466732_441659 3300042656 Unclassified 3235
116 Ga0466703_210632 3300042636 Unclassified 20532
117 Ga0466708_005726 3300042652 Bacteria 11867
118 Ga0466727_014180 3300042655 Bacteria 1931
119 Ga0466690_100806 3300042590 Bacteria 4964
120 Ga0466690_247613 3300042590 Bacteria 6308
121 Ga0466692_004094 3300042591 Bacteria 26840
122 Ga0466691_032873 3300042593 Bacteria 12318
123 Ga0123356_10352020 3300010049 Archaea 1597
124 Ga0123356_12625388 3300010049 Bacteria 631
125 Ga0123354_10541655 3300010882 Bacteria 883
126 Ga0466710_369441 3300042613 Bacteria 1892
127 Ga0466726_019615 3300042619 Bacteria 2684
128 Ga0466729_075862 3300042621 Bacteria 5112
129 Ga0466706_032042 3300042599 Unclassified 1415
130 Ga0466706_128607 3300042599 Bacteria 6933
131 Ga0466706_130352 3300042599 Bacteria 33832
132 Ga0466706_255718 3300042599 Bacteria 9171
133 Ga0466700_431232 3300042600 Bacteria 1616
134 Ga0466713_065519 3300042602 Bacteria 19812
135 JGI24702J35022_10000521 3300002462 Bacteria 23268
136 JGI24696J40584_12802985 3300002834 Bacteria 873
137 Ga0072941_1289540 3300005201 Bacteria 1768
138 Ga0102734_1010619 3300007129 Bacteria 2614
139 Ga0466697_197696 3300042611 Bacteria 22639
140 Ga0466733_078603 3300042659 Bacteria 14665
141 Ga0466733_194160 3300042659 Bacteria 1752
142 Ga0466729_217256 3300042621 Bacteria 12485
143 Ga0466704_543650 3300042643 Bacteria 22881
144 Ga0466708_081429 3300042652 Bacteria 11682
145 Ga0466708_289037 3300042652 Bacteria 4318
146 Ga0160467_104767 3300012829 Bacteria 1845
147 Ga0466657_390377 3300042582 Bacteria 1146
148 Ga0466690_270057 3300042590 Bacteria 3283
149 Ga0466695_005018 3300042595 Bacteria 3772
150 Ga0466696_051840 3300042596 Bacteria 26856
151 Ga0123356_10062091 3300010049 Bacteria 3490
152 Ga0123353_10051540 3300010167 Bacteria 6568
153 Ga0123353_10251847 3300010167 Bacteria 2734
154 Ga0466710_060675 3300042613 Bacteria 5161
155 Ga0466715_026465 3300042616 Bacteria 99999
156 Ga0466723_180229 3300042618 Bacteria 19998
157 Ga0466726_376057 3300042619 Bacteria 4503
158 Ga0466726_424394 3300042619 Bacteria 1525
159 Ga0466728_015945 3300042620 Bacteria 3595
160 Ga0466728_130780 3300042620 Bacteria 9493
161 Ga0466700_249634 3300042600 Bacteria 1468
162 Ga0466707_233245 3300042601 Bacteria 2719
163 Ga0466717_252053 3300042604 Bacteria 1084
164 Ga0466716_133964 3300042605 Bacteria 5821
165 JGI24705J35276_12202141 3300002504 Bacteria 1631
166 Ga0466733_003427 3300042659 Bacteria 4336
167 Ga0466692_102244 3300042591 Bacteria 27959
168 Ga0123356_10027617 3300010049 Bacteria 5318
169 Ga0123356_10645268 3300010049 Bacteria 1226
170 Ga0123353_10006523 3300010167 Bacteria 15545
171 Ga0123353_10166326 3300010167 Bacteria 3505
172 Ga0123353_10767826 3300010167 Viruses 1338
173 Ga0123353_11216719 3300010167 Bacteria 987
174 Ga0123353_12932946 3300010167 Bacteria 555
175 Ga0123354_10393940 3300010882 Bacteria 1180
176 Ga0466715_023151 3300042616 Bacteria 3388
177 Ga0466723_250414 3300042618 Bacteria 18038
178 Ga0466722_179951 3300042609 Bacteria 1465
179 IMNBL1DRAFT_c0001357 3300000062 Bacteria 18416
180 IMNBL1DRAFT_c0011263 3300000062 Bacteria 4192

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042603 Ga0466714_027987 Ga0466714_027987_11290_11721 132
2 3300005200 Ga0072940_1158085 Ga0072940_11580852 137
3 3300042659 Ga0466733_194160 Ga0466733_194160_418_831 137
4 3300042582 Ga0466657_068092 Ga0466657_068092_122591_123007 138
5 3300042593 Ga0466691_119991 Ga0466691_119991_28060_28476 138
6 3300042599 Ga0466706_024744 Ga0466706_024744_23344_23760 138
7 3300042599 Ga0466706_032042 Ga0466706_032042_223_639 138
8 3300042599 Ga0466706_128607 Ga0466706_128607_3624_4040 138
9 3300042599 Ga0466706_225176 Ga0466706_225176_15561_15977 138
10 3300042599 Ga0466706_255718 Ga0466706_255718_2986_3402 138
11 3300042603 Ga0466714_047059 Ga0466714_047059_2739_3155 138
12 3300042603 Ga0466714_098344 Ga0466714_098344_257_673 138
13 3300042652 Ga0466708_005726 Ga0466708_005726_9831_10247 138
14 3300042656 Ga0466732_134431 Ga0466732_134431_491_907 138
15 3300000062 IMNBL1DRAFT_c0002486 IMNBL1DRAFT_000248611 139
16 3300042599 Ga0466706_211053 Ga0466706_211053_64315_64734 139
17 3300042605 Ga0466716_520514 Ga0466716_520514_2661_3080 139
18 3300042609 Ga0466722_250232 Ga0466722_250232_3058_3477 139
19 3300042614 Ga0466712_092176 Ga0466712_092176_1207_1626 139
20 3300042619 Ga0466726_424394 Ga0466726_424394_159_578 139
21 3300042620 Ga0466728_104727 Ga0466728_104727_734_1153 139
22 3300042655 Ga0466727_014180 Ga0466727_014180_683_1102 139
23 iso_pr_bacteria 2820768849 2820770045 139
24 iso_pr_bacteria 2820774381 2820775251 139
25 3300005071 Ga0068302_10261506 Ga0068302_102615062 140
26 3300009826 Ga0123355_10001369 Ga0123355_1000136935 140
27 3300010167 Ga0123353_10000053 Ga0123353_10000053124 140
28 3300042590 Ga0466690_024191 Ga0466690_024191_682_1104 140
29 3300042590 Ga0466690_231717 Ga0466690_231717_7253_7675 140
30 3300042590 Ga0466690_247613 Ga0466690_247613_380_802 140
31 3300042591 Ga0466692_102244 Ga0466692_102244_24116_24538 140
32 3300042593 Ga0466691_032873 Ga0466691_032873_873_1295 140
33 3300042593 Ga0466691_091910 Ga0466691_091910_3805_4227 140
34 3300042599 Ga0466706_130352 Ga0466706_130352_14264_14686 140
35 3300042601 Ga0466707_173327 Ga0466707_173327_2311_2733 140
36 3300042603 Ga0466714_077188 Ga0466714_077188_305_727 140
37 3300042605 Ga0466716_061134 Ga0466716_061134_423_845 140
38 3300042606 Ga0466719_244456 Ga0466719_244456_477_899 140
39 3300042606 Ga0466719_386651 Ga0466719_386651_312_734 140
40 3300042606 Ga0466719_572480 Ga0466719_572480_1337_1759 140
41 3300042612 Ga0466705_012668 Ga0466705_012668_1762_2184 140
42 3300042612 Ga0466705_220469 Ga0466705_220469_692_1114 140
43 3300042616 Ga0466715_023151 Ga0466715_023151_252_674 140
44 3300042616 Ga0466715_117071 Ga0466715_117071_372_794 140
45 3300042616 Ga0466715_173123 Ga0466715_173123_372_794 140
46 3300042617 Ga0466718_047477 Ga0466718_047477_140_562 140
47 3300042618 Ga0466723_180229 Ga0466723_180229_12736_13158 140
48 3300042618 Ga0466723_250414 Ga0466723_250414_1456_1878 140
49 3300042620 Ga0466728_015945 Ga0466728_015945_856_1278 140
50 3300042620 Ga0466728_332643 Ga0466728_332643_2858_3280 140
51 3300042643 Ga0466704_062076 Ga0466704_062076_3298_3720 140
52 3300042648 Ga0466709_127340 Ga0466709_127340_2431_2853 140
53 3300042652 Ga0466708_081429 Ga0466708_081429_10842_11264 140
54 3300042652 Ga0466708_264419 Ga0466708_264419_47986_48408 140
55 3300042652 Ga0466708_289037 Ga0466708_289037_2596_3018 140
56 3300042654 Ga0466725_198449 Ga0466725_198449_70_492 140
57 3300042656 Ga0466732_394096 Ga0466732_394096_2690_3112 140
58 iso_pr_bacteria 2940195863 2940198015 140
59 2225789004 2227601850 2228168071 141
60 3300000062 IMNBL1DRAFT_c0007092 IMNBL1DRAFT_00070924 141
61 3300000062 IMNBL1DRAFT_c0054762 IMNBL1DRAFT_00547623 141
62 3300005200 Ga0072940_1103344 Ga0072940_11033442 141
63 3300007129 Ga0102734_1010619 Ga0102734_10106194 141
64 3300010049 Ga0123356_10645268 Ga0123356_106452682 141
65 3300012829 Ga0160467_104767 Ga0160467_1047671 141
66 3300042582 Ga0466657_199242 Ga0466657_199242_1401_1826 141
67 3300042591 Ga0466692_004094 Ga0466692_004094_18828_19253 141
68 3300042601 Ga0466707_233245 Ga0466707_233245_938_1363 141
69 3300042603 Ga0466714_133436 Ga0466714_133436_128_553 141
70 3300042605 Ga0466716_133964 Ga0466716_133964_3267_3692 141
71 3300042610 Ga0466698_002753 Ga0466698_002753_184_609 141
72 3300042613 Ga0466710_060675 Ga0466710_060675_1231_1656 141
73 3300042614 Ga0466712_320872 Ga0466712_320872_62_487 141
74 3300042616 Ga0466715_506549 Ga0466715_506549_2776_3201 141
75 3300042617 Ga0466718_112585 Ga0466718_112585_1669_2094 141
76 3300042621 Ga0466729_075862 Ga0466729_075862_2468_2893 141
77 3300042621 Ga0466729_099720 Ga0466729_099720_1706_2131 141
78 3300042656 Ga0466732_190481 Ga0466732_190481_136_561 141
79 3300042659 Ga0466733_006487 Ga0466733_006487_787_1212 141
80 3300042659 Ga0466733_021781 Ga0466733_021781_136_561 141
81 iso_pr_bacteria 2820736622 2820737914 141
82 iso_pr_bacteria 2820740053 2820741733 141
83 iso_pr_bacteria 2920168565 2920170155 141
84 3300000062 IMNBL1DRAFT_c0001357 IMNBL1DRAFT_000135714 142
85 3300002462 JGI24702J35022_10038705 JGI24702J35022_100387052 142
86 3300005200 Ga0072940_1158086 Ga0072940_11580862 142
87 3300005201 Ga0072941_1289540 Ga0072941_12895402 142
88 3300010049 Ga0123356_10027617 Ga0123356_100276172 142
89 3300010049 Ga0123356_10062091 Ga0123356_100620914 142
90 3300010049 Ga0123356_12792473 Ga0123356_127924732 142
91 3300010167 Ga0123353_11354008 Ga0123353_113540082 142
92 3300010167 Ga0123353_12932946 Ga0123353_129329461 142
93 3300042590 Ga0466690_090562 Ga0466690_090562_2437_2865 142
94 3300042590 Ga0466690_418022 Ga0466690_418022_6440_6868 142
95 3300042596 Ga0466696_051840 Ga0466696_051840_12726_13154 142
96 3300042596 Ga0466696_075613 Ga0466696_075613_1781_2209 142
97 3300042597 Ga0466699_400731 Ga0466699_400731_224_652 142
98 3300042601 Ga0466707_000364 Ga0466707_000364_80_508 142
99 3300042606 Ga0466719_125870 Ga0466719_125870_257_685 142
100 3300042615 Ga0466711_126881 Ga0466711_126881_4995_5423 142
101 3300042616 Ga0466715_026465 Ga0466715_026465_54534_54962 142
102 3300042618 Ga0466723_138623 Ga0466723_138623_3974_4402 142
103 3300042619 Ga0466726_019615 Ga0466726_019615_1979_2407 142
104 3300042619 Ga0466726_447449 Ga0466726_447449_1074_1502 142
105 3300042620 Ga0466728_228281 Ga0466728_228281_871_1299 142
106 3300042621 Ga0466729_217256 Ga0466729_217256_5655_6083 142
107 3300042643 Ga0466704_445202 Ga0466704_445202_1471_1899 142
108 3300042655 Ga0466727_274524 Ga0466727_274524_12363_12791 142
109 3300005201 Ga0072941_1066306 Ga0072941_10663066 143
110 3300042582 Ga0466657_390377 Ga0466657_390377_313_744 143
111 3300042596 Ga0466696_022111 Ga0466696_022111_886_1317 143
112 3300042596 Ga0466696_128027 Ga0466696_128027_3667_4098 143
113 3300042596 Ga0466696_427206 Ga0466696_427206_3346_3777 143
114 3300042598 Ga0466701_099379 Ga0466701_099379_588_1019 143
115 3300042600 Ga0466700_431232 Ga0466700_431232_557_988 143
116 3300042604 Ga0466717_103287 Ga0466717_103287_23_454 143
117 3300042604 Ga0466717_252053 Ga0466717_252053_263_694 143
118 3300042610 Ga0466698_045407 Ga0466698_045407_547_978 143
119 3300042610 Ga0466698_270872 Ga0466698_270872_2206_2637 143
120 3300042613 Ga0466710_369441 Ga0466710_369441_1388_1819 143
121 3300042618 Ga0466723_031620 Ga0466723_031620_21844_22275 143
122 3300042619 Ga0466726_055493 Ga0466726_055493_1477_1908 143
123 3300042619 Ga0466726_376057 Ga0466726_376057_2622_3053 143
124 3300042621 Ga0466729_114770 Ga0466729_114770_9110_9541 143
125 3300042622 Ga0466731_012581 Ga0466731_012581_757_1188 143
126 3300042643 Ga0466704_543650 Ga0466704_543650_21124_21555 143
127 3300042656 Ga0466732_441659 Ga0466732_441659_1325_1756 143
128 3300042659 Ga0466733_003427 Ga0466733_003427_2856_3287 143
129 3300042659 Ga0466733_078603 Ga0466733_078603_10531_10962 143
130 3300042659 Ga0466733_167667 Ga0466733_167667_1073_1504 143
131 3300000062 IMNBL1DRAFT_c0011263 IMNBL1DRAFT_00112633 144
132 3300002462 JGI24702J35022_10000521 JGI24702J35022_100005214 144
133 3300002504 JGI24705J35276_12202141 JGI24705J35276_122021412 144
134 3300002504 JGI24705J35276_12222574 JGI24705J35276_122225744 144
135 3300002504 JGI24705J35276_12236276 JGI24705J35276_122362769 144
136 3300010049 Ga0123356_11590634 Ga0123356_115906342 144
137 3300010167 Ga0123353_10006523 Ga0123353_1000652318 144
138 3300010167 Ga0123353_10051540 Ga0123353_100515402 144
139 3300010167 Ga0123353_10069440 Ga0123353_100694402 144
140 3300010167 Ga0123353_10166326 Ga0123353_101663264 144
141 3300010167 Ga0123353_10251847 Ga0123353_102518472 144
142 3300010167 Ga0123353_10746431 Ga0123353_107464313 144
143 3300010167 Ga0123353_10767826 Ga0123353_107678262 144
144 3300010167 Ga0123353_11216719 Ga0123353_112167192 144
145 3300010167 Ga0123353_12635477 Ga0123353_126354772 144
146 3300010882 Ga0123354_10093161 Ga0123354_100931612 144
147 3300010882 Ga0123354_10131627 Ga0123354_101316272 144
148 3300042600 Ga0466700_249634 Ga0466700_249634_965_1399 144
149 3300042605 Ga0466716_437183 Ga0466716_437183_3058_3492 144
150 3300042612 Ga0466705_370133 Ga0466705_370133_6437_6871 144
151 3300042621 Ga0466729_094959 Ga0466729_094959_4557_4991 144
152 3300042656 Ga0466732_332718 Ga0466732_332718_444_878 144
153 3300042659 Ga0466733_051789 Ga0466733_051789_1798_2232 144
154 3300005083 Ga0068305_10042196 Ga0068305_100421964 145
155 3300010882 Ga0123354_10541655 Ga0123354_105416551 145
156 3300042593 Ga0466691_124547 Ga0466691_124547_2821_3258 145
157 3300042609 Ga0466722_126917 Ga0466722_126917_107_544 145
158 3300042611 Ga0466697_065449 Ga0466697_065449_285_722 145
159 3300042611 Ga0466697_066086 Ga0466697_066086_286_723 145
160 3300042656 Ga0466732_156352 Ga0466732_156352_1162_1599 145
161 3300010049 Ga0123356_13025322 Ga0123356_130253221 146
162 3300010167 Ga0123353_10072870 Ga0123353_100728707 146
163 3300042590 Ga0466690_100806 Ga0466690_100806_312_752 146
164 3300042612 Ga0466705_043701 Ga0466705_043701_852_1292 146
165 3300042620 Ga0466728_130780 Ga0466728_130780_6205_6645 146
166 3300000062 IMNBL1DRAFT_c0009034 IMNBL1DRAFT_00090344 147
167 3300010882 Ga0123354_10393940 Ga0123354_103939403 147
168 3300042590 Ga0466690_270057 Ga0466690_270057_2490_2933 147
169 3300042609 Ga0466722_179951 Ga0466722_179951_1012_1455 147
170 3300002834 JGI24696J40584_12802985 JGI24696J40584_128029852 148
171 3300010167 Ga0123353_10351648 Ga0123353_103516482 148
172 3300042595 Ga0466695_005018 Ga0466695_005018_1513_1959 148
173 3300042599 Ga0466706_059465 Ga0466706_059465_1877_2323 148
174 3300042636 Ga0466703_210632 Ga0466703_210632_11079_11525 148
175 3300010049 Ga0123356_10051107 Ga0123356_100511071 149
176 3300042611 Ga0466697_197696 Ga0466697_197696_13989_14438 149
177 3300010167 Ga0123353_10863347 Ga0123353_108633473 150
178 3300042602 Ga0466713_065519 Ga0466713_065519_9128_9580 150
179 3300042636 Ga0466703_104748 Ga0466703_104748_2899_3351 150
180 3300010049 Ga0123356_10728025 Ga0123356_107280252 151
181 3300010167 Ga0123353_10303281 Ga0123353_103032814 152
182 3300042602 Ga0466713_063972 Ga0466713_063972_75_539 154
183 3300010049 Ga0123356_10352020 Ga0123356_103520202 157
184 3300042596 Ga0466696_124454 Ga0466696_124454_11288_11770 160
185 3300010049 Ga0123356_12625388 Ga0123356_126253881 170
186 3300010049 Ga0123356_11405145 Ga0123356_114051451 178

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02657 SufE Fe-S metabolism associated domain 22 140 0.97

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.