Protein Family IF05138

Metagenome Isolate
143 Members
69 Samples
120 Scaffolds
333.82 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_104973|Ga0466696_104973_1537_2739
Length
400 aa
Sequence
MNDFYIVAKKYSSKNFDENNCGENFAWLFRMTRSFLLRHYKICLFLFSTYFSHTFNEVFNLQHLSTMTATIYYDKDADLSQLKGKTIAILGYGSQGHAHAQNLRDSGCEVIVAEVKGTHNYELAVQDKFKPLTTEEAVKRADLIVLTLPDELQANIFETQIRPNLSEGNLIIATHGFNVHYGQFNMPKGVYAILIAPKGPGHLVRSEFTKGGGVPCLIALGEGAGDKERKIGLAYAKGIGGTRGGVIETTFAEETETDLFGEQVVLCGGVSALVQKAFEVLVEAGYQPEMAYFECMHELKLIVDLFYQGGLNYMRYSVSNTAEFGDYTRGSRIITDETKTEMKKILTEIQTGEFAKEWLLENKVGAPKFKRIRAIQRQHQLEEVGRRLRKLMSWIDAKEF

📊 Sample Types

Isolate 16.1%
Metagenome 83.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Unclassified 30.4%
Kalotermitidae 18.8%
Tenebrionidae 5.8%
Rhinotermitidae 4.3%
Blattidae 2.9%
Termopsidae 2.9%
Culicidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
2 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
3 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
4 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
11 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
12 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
15 2820918931 Unclassified Actinobacteria Emb289P3bin56 Isolate Unclassified
16 2820044805 Unclassified Proteobacteria Th196P4bin15 Isolate Unclassified
17 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2820068815 Unclassified Proteobacteria Nt197P3bin4 Isolate Unclassified
21 2820193510 Unclassified Planctomycetes Emb289P3bin83 Isolate Unclassified
22 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
23 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
26 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
29 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
30 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
31 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
32 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
33 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
34 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
35 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
36 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
39 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
40 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
41 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
42 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
43 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
44 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
45 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
46 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
47 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
48 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
49 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
50 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
51 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
52 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
53 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
54 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
55 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
56 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
57 2820189034 Unclassified Planctomycetes Emb289P4bin17 Isolate Unclassified
58 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
59 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
60 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
61 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
62 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
63 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
64 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
65 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
66 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
67 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
68 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
69 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_117323 3300042612 Bacteria 23353
2 Ga0466733_191977 3300042659 Bacteria 4776
3 Ga0123357_10000691 3300009784 Bacteria 33780
4 Ga0466711_151663 3300042615 Unclassified 6178
5 Ga0466711_167319 3300042615 Bacteria 5804
6 Ga0466723_096474 3300042618 Bacteria 2180
7 Ga0466726_293994 3300042619 Bacteria 20611
8 Ga0466728_319542 3300042620 Bacteria 12559
9 Ga0466728_340153 3300042620 Unclassified 1811
10 Ga0466731_169964 3300042622 Unclassified 1710
11 Ga0466724_59189 3300042649 Bacteria 1212
12 Ga0466727_000584 3300042655 Bacteria 3357
13 Ga0123356_10066201 3300010049 Bacteria 3382
14 Ga0123353_10029185 3300010167 Bacteria 8495
15 Ga0466732_008246 3300042656 Bacteria 2412
16 Ga0466715_534893 3300042616 Bacteria 57298
17 Ga0466703_077650 3300042636 Bacteria 5648
18 Ga0466704_470314 3300042643 Bacteria 3089
19 Ga0466708_445113 3300042652 Bacteria 15046
20 Ga0466725_439589 3300042654 Bacteria 1096
21 Ga0466698_440801 3300042610 Bacteria 1562
22 Ga0123353_10000676 3300010167 Bacteria 41652
23 Ga0466705_008734 3300042612 Bacteria 11580
24 Ga0466705_326958 3300042612 Unclassified 7949
25 JGI24702J35022_10008743 3300002462 Bacteria 5715
26 JGI24702J35022_10019152 3300002462 Unclassified 3725
27 Ga0466711_042008 3300042615 Bacteria 7110
28 Ga0466711_192975 3300042615 Bacteria 7828
29 Ga0466715_461929 3300042616 Bacteria 5509
30 Ga0466723_245669 3300042618 Bacteria 17901
31 Ga0466726_198510 3300042619 Bacteria 11133
32 Ga0466695_130112 3300042595 Bacteria 1786
33 Ga0466729_204055 3300042621 Bacteria 4711
34 Ga0466704_596816 3300042643 Bacteria 34729
35 Ga0123353_10002645 3300010167 Bacteria 22293
36 Ga0466705_317371 3300042612 Bacteria 146251
37 Ga0466715_011393 3300042616 Bacteria 13850
38 Ga0466715_244350 3300042616 Unclassified 12691
39 Ga0466715_394986 3300042616 Bacteria 4179
40 Ga0466723_108119 3300042618 Bacteria 2291
41 Ga0466728_092277 3300042620 Bacteria 3183
42 Ga0466691_145825 3300042593 Bacteria 6874
43 Ga0466695_089315 3300042595 Bacteria 3236
44 Ga0466695_234822 3300042595 Bacteria 1823
45 Ga0466734_140169 3300042623 Bacteria 2493
46 Ga0466704_370101 3300042643 Unclassified 2704
47 Ga0466708_254310 3300042652 Bacteria 21277
48 Ga0466716_250653 3300042605 Unclassified 17921
49 Ga0466719_306626 3300042606 Bacteria 7564
50 Ga0466720_213910 3300042607 Bacteria 1488
51 Ga0466705_027419 3300042612 Bacteria 37190
52 Ga0466733_208883 3300042659 Bacteria 1480
53 Ga0530661_002401 3300056564 Bacteria 7115
54 JGI24698J34947_10009370 3300002449 Bacteria 5376
55 JGI24695J34938_10034023 3300002450 Bacteria 2340
56 Ga0466715_270412 3300042616 Bacteria 17234
57 Ga0466723_104235 3300042618 Unclassified 1613
58 Ga0466691_017755 3300042593 Bacteria 6431
59 Ga0466702_194490 3300042635 Bacteria 1337
60 Ga0466704_100934 3300042643 Unclassified 12931
61 Ga0466708_017782 3300042652 Bacteria 33054
62 Ga0466700_017374 3300042600 Bacteria 2432
63 Ga0466707_123132 3300042601 Bacteria 19417
64 Ga0466719_204773 3300042606 Bacteria 11115
65 Ga0123355_10000365 3300009826 Bacteria 58534
66 Ga0123356_10147226 3300010049 Unclassified 2332
67 Ga0123353_10005063 3300010167 Bacteria 17199
68 Ga0123353_10490788 3300010167 Unclassified 1793
69 Ga0123354_10147382 3300010882 Unclassified 2873
70 Ga0466705_126207 3300042612 Bacteria 16830
71 Ga0466733_135895 3300042659 Bacteria 10236
72 Ga0562375_1591 3300056856 Unclassified 29702
73 JGI24702J35022_10018400 3300002462 Bacteria 3810
74 Ga0466715_015911 3300042616 Bacteria 29550
75 Ga0466715_049262 3300042616 Bacteria 18729
76 Ga0466715_154491 3300042616 Bacteria 1757
77 Ga0466723_172984 3300042618 Bacteria 5898
78 Ga0466729_080038 3300042621 Bacteria 4482
79 Ga0466690_198399 3300042590 Bacteria 1614
80 Ga0466690_372317 3300042590 Unclassified 9884
81 Ga0466696_489378 3300042596 Unclassified 2722
82 Ga0466699_037930 3300042597 Bacteria 1975
83 Ga0466703_199351 3300042636 Unclassified 2312
84 Ga0466704_058830 3300042643 Bacteria 7462
85 Ga0466704_214644 3300042643 Bacteria 2526
86 Ga0466704_273138 3300042643 Bacteria 1623
87 Ga0466704_522542 3300042643 Bacteria 4608
88 Ga0466708_250905 3300042652 Bacteria 9024
89 Ga0466716_356899 3300042605 Bacteria 1491
90 Ga0466716_506437 3300042605 Bacteria 10970
91 Ga0123355_10015304 3300009826 Bacteria 12045
92 Ga0562377_0071 3300056842 Bacteria 439264
93 Ga0466711_279926 3300042615 Bacteria 5252
94 Ga0466723_075017 3300042618 Bacteria 7830
95 Ga0466729_028638 3300042621 Bacteria 4330
96 Ga0160435_1005080 3300012857 Bacteria 3009
97 Ga0466690_185439 3300042590 Bacteria 2176
98 Ga0466696_104973 3300042596 Bacteria 4919
99 Ga0466699_152121 3300042597 Bacteria 2566
100 Ga0466699_367546 3300042597 Unclassified 1596
101 Ga0466729_284764 3300042621 Unclassified 3309
102 Ga0466703_237278 3300042636 Bacteria 6250
103 Ga0466703_427775 3300042636 Bacteria 5767
104 Ga0466727_022509 3300042655 Bacteria 6089
105 Ga0466716_182395 3300042605 Bacteria 1608
106 Ga0123355_10615969 3300009826 Bacteria 1282
107 Ga0123353_10011371 3300010167 Bacteria 12534
108 Ga0466705_065028 3300042612 Bacteria 59479
109 Ga0562376_1213 3300056857 Bacteria 37525
110 Ga0466718_139942 3300042617 Bacteria 2932
111 Ga0466692_070264 3300042591 Bacteria 8232
112 Ga0466693_196591 3300042592 Bacteria 1118
113 Ga0466703_178509 3300042636 Bacteria 4792
114 Ga0466704_412297 3300042643 Bacteria 21026
115 Ga0466700_361546 3300042600 Bacteria 1488
116 Ga0466717_289125 3300042604 Bacteria 4243
117 Ga0466698_242059 3300042610 Bacteria 9355
118 Ga0123355_10062490 3300009826 Bacteria 6010
119 Ga0123353_10001298 3300010167 Bacteria 30644
120 Ga0123353_10244064 3300010167 Bacteria 2788

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10015304 Ga0123355_100153048 314
2 3300042600 Ga0466700_361546 Ga0466700_361546_15_1010 314
3 3300009826 Ga0123355_10000365 Ga0123355_100003659 317
4 3300010167 Ga0123353_10000676 Ga0123353_1000067641 320
5 3300042615 Ga0466711_167319 Ga0466711_167319_4147_5142 320
6 3300042616 Ga0466715_011393 Ga0466715_011393_8881_9876 320
7 3300042616 Ga0466715_461929 Ga0466715_461929_1515_2510 320
8 3300042618 Ga0466723_108119 Ga0466723_108119_426_1421 320
9 3300042652 Ga0466708_017782 Ga0466708_017782_9505_10500 320
10 3300042652 Ga0466708_254310 Ga0466708_254310_8905_9900 320
11 3300042593 Ga0466691_017755 Ga0466691_017755_497_1492 321
12 3300042607 Ga0466720_213910 Ga0466720_213910_306_1301 321
13 3300009826 Ga0123355_10615969 Ga0123355_106159691 322
14 3300042612 Ga0466705_126207 Ga0466705_126207_7476_8471 323
15 3300042643 Ga0466704_470314 Ga0466704_470314_690_1685 323
16 3300012857 Ga0160435_1005080 Ga0160435_10050801 324
17 3300042616 Ga0466715_394986 Ga0466715_394986_738_1733 326
18 3300042636 Ga0466703_178509 Ga0466703_178509_2287_3282 326
19 3300056564 Ga0530661_002401 Ga0530661_002401_5608_6627 326
20 3300056856 Ga0562375_1591 Ga0562375_1591_10803_11822 326
21 3300056857 Ga0562376_1213 Ga0562376_1213_10125_11144 328
22 3300042597 Ga0466699_152121 Ga0466699_152121_1128_2165 329
23 iso_pr_bacteria 2781125655 2781317518 329
24 iso_pr_bacteria 2820918931 2820920235 329
25 iso_pr_bacteria 8064531044 8064534908 329
26 3300042590 Ga0466690_185439 Ga0466690_185439_373_1365 330
27 3300042597 Ga0466699_037930 Ga0466699_037930_824_1816 330
28 3300042601 Ga0466707_123132 Ga0466707_123132_2080_3072 330
29 3300042615 Ga0466711_279926 Ga0466711_279926_2481_3473 330
30 3300042635 Ga0466702_194490 Ga0466702_194490_23_1015 330
31 3300042656 Ga0466732_008246 Ga0466732_008246_388_1380 330
32 3300042659 Ga0466733_135895 Ga0466733_135895_9211_10203 330
33 3300042659 Ga0466733_208883 Ga0466733_208883_285_1277 330
34 iso_pr_bacteria 2820044805 2820045700 330
35 iso_pr_bacteria 2820068815 2820070239 330
36 3300002449 JGI24698J34947_10009370 JGI24698J34947_100093705 331
37 3300042590 Ga0466690_198399 Ga0466690_198399_227_1222 331
38 3300042605 Ga0466716_506437 Ga0466716_506437_1615_2610 331
39 3300042612 Ga0466705_027419 Ga0466705_027419_27443_28438 331
40 3300042612 Ga0466705_065028 Ga0466705_065028_48345_49340 331
41 3300042612 Ga0466705_317371 Ga0466705_317371_10645_11640 331
42 3300042616 Ga0466715_015911 Ga0466715_015911_18361_19356 331
43 3300042616 Ga0466715_049262 Ga0466715_049262_9968_10963 331
44 3300042616 Ga0466715_154491 Ga0466715_154491_24_1019 331
45 3300042618 Ga0466723_075017 Ga0466723_075017_1345_2340 331
46 3300042618 Ga0466723_096474 Ga0466723_096474_516_1511 331
47 3300042643 Ga0466704_412297 Ga0466704_412297_8920_9915 331
48 3300042643 Ga0466704_596816 Ga0466704_596816_5749_6744 331
49 3300042655 Ga0466727_000584 Ga0466727_000584_1988_2983 331
50 iso_pr_bacteria 2820013017 2820014205 331
51 iso_pr_bacteria 2820014844 2820016415 331
52 3300009826 Ga0123355_10062490 Ga0123355_100624904 332
53 3300042612 Ga0466705_117323 Ga0466705_117323_17126_18124 332
54 3300042621 Ga0466729_080038 Ga0466729_080038_2774_3772 332
55 3300002462 JGI24702J35022_10019152 JGI24702J35022_100191522 333
56 3300042590 Ga0466690_372317 Ga0466690_372317_563_1567 334
57 3300042591 Ga0466692_070264 Ga0466692_070264_1074_2078 334
58 3300042592 Ga0466693_196591 Ga0466693_196591_61_1065 334
59 3300042595 Ga0466695_089315 Ga0466695_089315_1200_2204 334
60 3300042595 Ga0466695_130112 Ga0466695_130112_535_1539 334
61 3300042595 Ga0466695_234822 Ga0466695_234822_417_1421 334
62 3300042597 Ga0466699_367546 Ga0466699_367546_573_1577 334
63 3300042600 Ga0466700_017374 Ga0466700_017374_1265_2269 334
64 3300042604 Ga0466717_289125 Ga0466717_289125_1123_2127 334
65 3300042605 Ga0466716_250653 Ga0466716_250653_1160_2164 334
66 3300042606 Ga0466719_204773 Ga0466719_204773_7941_8945 334
67 3300042610 Ga0466698_242059 Ga0466698_242059_7282_8286 334
68 3300042610 Ga0466698_440801 Ga0466698_440801_59_1063 334
69 3300042612 Ga0466705_008734 Ga0466705_008734_3826_4830 334
70 3300042612 Ga0466705_326958 Ga0466705_326958_6578_7582 334
71 3300042615 Ga0466711_042008 Ga0466711_042008_4901_5905 334
72 3300042615 Ga0466711_151663 Ga0466711_151663_3867_4871 334
73 3300042616 Ga0466715_244350 Ga0466715_244350_5022_6026 334
74 3300042616 Ga0466715_270412 Ga0466715_270412_8672_9676 334
75 3300042616 Ga0466715_534893 Ga0466715_534893_45368_46372 334
76 3300042617 Ga0466718_139942 Ga0466718_139942_489_1493 334
77 3300042618 Ga0466723_172984 Ga0466723_172984_4516_5520 334
78 3300042618 Ga0466723_245669 Ga0466723_245669_10703_11707 334
79 3300042619 Ga0466726_198510 Ga0466726_198510_9877_10881 334
80 3300042620 Ga0466728_319542 Ga0466728_319542_860_1864 334
81 3300042621 Ga0466729_028638 Ga0466729_028638_2237_3241 334
82 3300042621 Ga0466729_204055 Ga0466729_204055_2301_3305 334
83 3300042621 Ga0466729_284764 Ga0466729_284764_1912_2916 334
84 3300042622 Ga0466731_169964 Ga0466731_169964_228_1232 334
85 3300042623 Ga0466734_140169 Ga0466734_140169_273_1277 334
86 3300042636 Ga0466703_077650 Ga0466703_077650_624_1628 334
87 3300042636 Ga0466703_199351 Ga0466703_199351_534_1538 334
88 3300042636 Ga0466703_237278 Ga0466703_237278_1138_2142 334
89 3300042636 Ga0466703_427775 Ga0466703_427775_4381_5385 334
90 3300042643 Ga0466704_058830 Ga0466704_058830_1993_2997 334
91 3300042643 Ga0466704_370101 Ga0466704_370101_1685_2689 334
92 3300042649 Ga0466724_59189 Ga0466724_59189_47_1051 334
93 3300042652 Ga0466708_445113 Ga0466708_445113_569_1573 334
94 3300042654 Ga0466725_439589 Ga0466725_439589_44_1048 334
95 3300042655 Ga0466727_022509 Ga0466727_022509_4515_5519 334
96 iso_pr_bacteria 2820180635 2820180775 334
97 iso_pr_bacteria 2820189034 2820190398 334
98 iso_pr_bacteria 2820201435 2820202368 334
99 iso_pr_bacteria 2820205024 2820205439 334
100 iso_pr_bacteria 2820229114 2820230989 334
101 3300002450 JGI24695J34938_10034023 JGI24695J34938_100340231 335
102 3300002462 JGI24702J35022_10008743 JGI24702J35022_100087436 335
103 3300002462 JGI24702J35022_10018400 JGI24702J35022_100184004 335
104 3300009784 Ga0123357_10000691 Ga0123357_100006912 335
105 3300010049 Ga0123356_10147226 Ga0123356_101472262 335
106 3300010167 Ga0123353_10001298 Ga0123353_100012987 335
107 3300010167 Ga0123353_10002645 Ga0123353_100026456 335
108 3300010167 Ga0123353_10005063 Ga0123353_1000506317 335
109 3300010167 Ga0123353_10011371 Ga0123353_100113717 335
110 3300010167 Ga0123353_10029185 Ga0123353_100291856 335
111 3300010167 Ga0123353_10244064 Ga0123353_102440642 335
112 3300010167 Ga0123353_10490788 Ga0123353_104907882 335
113 3300010882 Ga0123354_10147382 Ga0123354_101473823 335
114 3300042596 Ga0466696_489378 Ga0466696_489378_619_1626 335
115 3300042606 Ga0466719_306626 Ga0466719_306626_1570_2577 335
116 3300042618 Ga0466723_104235 Ga0466723_104235_329_1336 335
117 3300042619 Ga0466726_293994 Ga0466726_293994_2286_3293 335
118 3300042643 Ga0466704_214644 Ga0466704_214644_1242_2249 335
119 3300042643 Ga0466704_273138 Ga0466704_273138_584_1591 335
120 iso_pr_bacteria 2820171952 2820173248 335
121 iso_pr_bacteria 2820193510 2820195757 335
122 3300010049 Ga0123356_10066201 Ga0123356_100662012 336
123 3300042620 Ga0466728_092277 Ga0466728_092277_1774_2790 338
124 3300042620 Ga0466728_340153 Ga0466728_340153_364_1380 338
125 3300042643 Ga0466704_100934 Ga0466704_100934_11354_12370 338
126 3300042643 Ga0466704_522542 Ga0466704_522542_466_1482 338
127 iso_pr_bacteria 2820110010 2820110703 338
128 iso_pr_bacteria 2706794701 2708049174 341
129 iso_pr_bacteria 2940239174 2940240110 341
130 iso_pr_bacteria 2940377351 2940377428 341
131 iso_pr_bacteria 2517572100 2517758618 343
132 iso_pr_bacteria 2639763185 2642344929 343
133 iso_pr_bacteria 2639763186 2642352971 343
134 iso_pr_bacteria 2857493320 2857493519 343
135 iso_pr_bacteria 2857498920 2857499545 343
136 3300042615 Ga0466711_192975 Ga0466711_192975_840_1889 349
137 3300042605 Ga0466716_182395 Ga0466716_182395_413_1465 350
138 3300042605 Ga0466716_356899 Ga0466716_356899_67_1143 358
139 3300042652 Ga0466708_250905 Ga0466708_250905_7686_8774 362
140 3300042659 Ga0466733_191977 Ga0466733_191977_150_1244 364
141 3300056842 Ga0562377_0071 Ga0562377_0071_284652_285746 364
142 3300042593 Ga0466691_145825 Ga0466691_145825_149_1255 368
143 3300042596 Ga0466696_104973 Ga0466696_104973_1537_2739 400

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain 251 394 1
PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain 82 245 0.99
PF00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain 82 147 0.9
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 74 150 0.85
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 86 172 0.84
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 86 174 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02826 GO:0051287 NAD binding MF
PF03446 GO:0050661 NADP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.