Protein Family IF05133

Metagenome Isolate
119 Members
43 Samples
117 Scaffolds
154.45 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_094981|Ga0466696_094981_228_788
Length
186 aa
Sequence
MRGKHIKIELSEEARNELEKFTRTGKHSDKLVTRAKLLHELDEAGGRKPLTQAKIAEKIGVDRRTVNDVKKAFLAADSAAVFLQRKKRRTPPVQPKITGEVEAHSIALACGPVPEGCAQWSVRLLADKSVELNYIDSISFKSVQRLLKKHNLNPTGIDKHEGERVGGWDTVVSREEYEQIFENRPA

📊 Sample Types

Isolate 1.7%
Metagenome 98.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 73.8%
Kalotermitidae 19.0%
Unclassified 4.8%
Rhinotermitidae 2.4%

🌳 Taxonomy

Archaea 10
Bacteria 90
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
14 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
15 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
16 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
17 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
22 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
23 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
26 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
27 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
28 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
29 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
30 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
37 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24702J35022_10218173 3300002462 Bacteria 1098
2 Ga0072941_1262486 3300005201 Bacteria 732
3 Ga0466718_011460 3300042617 Bacteria 2087
4 Ga0123353_10436556 3300010167 Bacteria 1933
5 Ga0415639_157231 3300038395 Bacteria 1220
6 Ga0466693_268105 3300042592 Bacteria 1733
7 Ga0466693_349608 3300042592 Bacteria 2019
8 Ga0466691_025627 3300042593 Unclassified 2001
9 Ga0466691_219786 3300042593 Unclassified 2659
10 Ga0466694_188519 3300042594 Archaea 1076
11 Ga0466694_275081 3300042594 Bacteria 1524
12 Ga0466696_142536 3300042596 Bacteria 1658
13 Ga0466696_192573 3300042596 Bacteria 5743
14 Ga0466700_349245 3300042600 Unclassified 1855
15 Ga0466700_392844 3300042600 Bacteria 1290
16 Ga0466700_443517 3300042600 Bacteria 1203
17 Ga0466697_142000 3300042611 Bacteria 1685
18 JGI24695J34938_10013286 3300002450 Bacteria 4331
19 JGI24700J35501_10355497 3300002508 Bacteria 649
20 Ga0072941_1134534 3300005201 Bacteria 759
21 Ga0466723_096893 3300042618 Bacteria 2350
22 Ga0466724_33287 3300042649 Bacteria 1376
23 Ga0123355_10003847 3300009826 Bacteria 21716
24 Ga0123355_10549300 3300009826 Bacteria 1398
25 Ga0123356_10534086 3300010049 Bacteria 1332
26 Ga0466694_133138 3300042594 Bacteria 9904
27 Ga0466701_064861 3300042598 Bacteria 1654
28 Ga0466701_097728 3300042598 Bacteria 1092
29 Ga0466717_276440 3300042604 Archaea 1455
30 Ga0466698_336173 3300042610 Bacteria 1636
31 JGI24696J40584_12911302 3300002834 Bacteria 1258
32 Ga0466718_075314 3300042617 Bacteria 1093
33 Ga0466734_096095 3300042623 Bacteria 1360
34 Ga0466709_399299 3300042648 Bacteria 1399
35 Ga0123356_10376939 3300010049 Bacteria 1550
36 Ga0123353_10772305 3300010167 Unclassified 1333
37 Ga0123354_10269678 3300010882 Bacteria 1678
38 Ga0123354_10349376 3300010882 Bacteria 1321
39 Ga0466694_130300 3300042594 Bacteria 1541
40 Ga0466696_190597 3300042596 Bacteria 1362
41 Ga0466701_015202 3300042598 Bacteria 1627
42 Ga0466698_052220 3300042610 Bacteria 2325
43 JGI24705J35276_11838292 3300002504 Bacteria 707
44 Ga0072940_1113562 3300005200 Archaea 763
45 Ga0466731_035468 3300042622 Unclassified 1937
46 Ga0466734_162335 3300042623 Unclassified 1026
47 Ga0123356_10716877 3300010049 Bacteria 1170
48 Ga0123356_11563382 3300010049 Bacteria 815
49 Ga0123353_10686187 3300010167 Unclassified 1441
50 Ga0123353_10783357 3300010167 Bacteria 1320
51 Ga0466657_217663 3300042582 Bacteria 1079
52 Ga0466694_235537 3300042594 Archaea 1256
53 Ga0466722_150886 3300042609 Bacteria 3280
54 Ga0466705_383749 3300042612 Bacteria 32511
55 Ga0466733_101890 3300042659 Bacteria 2564
56 JGI24695J34938_10049043 3300002450 Bacteria 1857
57 JGI24695J34938_10073326 3300002450 Unclassified 1426
58 JGI24702J35022_10355360 3300002462 Bacteria 877
59 Ga0074263_100622 3300005485 Unclassified 2188
60 Ga0466715_162482 3300042616 Bacteria 2706
61 Ga0466718_074936 3300042617 Bacteria 1640
62 Ga0466731_386701 3300042622 Unclassified 1458
63 Ga0123356_10386128 3300010049 Bacteria 1534
64 Ga0123353_10657762 3300010167 Bacteria 1482
65 Ga0123353_11418245 3300010167 Archaea 891
66 Ga0466693_029052 3300042592 Unclassified 1027
67 Ga0466701_029062 3300042598 Bacteria 3542
68 Ga0466700_373865 3300042600 Bacteria 1252
69 Ga0466697_230419 3300042611 Bacteria 1140
70 Ga0466733_022806 3300042659 Bacteria 1814
71 JGI24702J35022_10483535 3300002462 Bacteria 757
72 Ga0466710_044592 3300042613 Bacteria 1968
73 Ga0466723_079592 3300042618 Bacteria 3477
74 Ga0466704_170250 3300042643 Bacteria 9534
75 Ga0466704_252832 3300042643 Bacteria 2148
76 Ga0123356_10168418 3300010049 Bacteria 2198
77 Ga0123356_10767043 3300010049 Unclassified 1135
78 Ga0123353_10689245 3300010167 Bacteria 1437
79 Ga0123354_10191214 3300010882 Archaea 2291
80 Ga0466656_072970 3300042550 Unclassified 1474
81 Ga0466691_060037 3300042593 Bacteria 10452
82 Ga0466694_146673 3300042594 Bacteria 2179
83 Ga0466701_083131 3300042598 Bacteria 1417
84 Ga0466717_284382 3300042604 Unclassified 1480
85 Ga0466733_206077 3300042659 Bacteria 1348
86 JGI24702J35022_10192349 3300002462 Bacteria 1164
87 JGI24702J35022_10425814 3300002462 Bacteria 805
88 JGI24705J35276_12048714 3300002504 Unclassified 915
89 Ga0466723_009217 3300042618 Bacteria 1743
90 Ga0466728_212165 3300042620 Bacteria 3853
91 Ga0466702_096884 3300042635 Bacteria 1568
92 Ga0466725_325473 3300042654 Bacteria 2725
93 Ga0123356_10431039 3300010049 Bacteria 1463
94 Ga0123356_12542796 3300010049 Bacteria 641
95 Ga0123353_11451054 3300010167 Bacteria 878
96 Ga0466693_309653 3300042592 Bacteria 1411
97 Ga0466693_389680 3300042592 Unclassified 1051
98 Ga0466701_072830 3300042598 Bacteria 1602
99 Ga0466721_329163 3300042608 Bacteria 1319
100 Ga0466722_126375 3300042609 Archaea 1965
101 Ga0466718_161653 3300042617 Archaea 1460
102 Ga0466731_223003 3300042622 Unclassified 1999
103 Ga0466734_093883 3300042623 Bacteria 1213
104 Ga0466702_003716 3300042635 Bacteria 1142
105 Ga0466725_061175 3300042654 Bacteria 1573
106 Ga0123356_10898356 3300010049 Bacteria 1057
107 Ga0123353_10365671 3300010167 Bacteria 2165
108 Ga0123353_11901181 3300010167 Archaea 734
109 Ga0123353_12143832 3300010167 Archaea 678
110 Ga0415639_117916 3300038395 Bacteria 1256
111 Ga0466695_119537 3300042595 Unclassified 1848
112 Ga0466696_073530 3300042596 Bacteria 1894
113 Ga0466696_094981 3300042596 Bacteria 4347
114 Ga0466696_107964 3300042596 Bacteria 1538
115 Ga0466696_214146 3300042596 Unclassified 1577
116 Ga0466701_047426 3300042598 Bacteria 3795
117 Ga0466717_022823 3300042604 Bacteria 1150

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042594 Ga0466694_275081 Ga0466694_275081_179_589 136
2 3300042582 Ga0466657_217663 Ga0466657_217663_399_848 149
3 3300042659 Ga0466733_022806 Ga0466733_022806_373_822 149
4 3300042593 Ga0466691_060037 Ga0466691_060037_8115_8570 151
5 3300042594 Ga0466694_188519 Ga0466694_188519_181_636 151
6 3300038395 Ga0415639_117916 Ga0415639_117916_94_555 153
7 3300038395 Ga0415639_157231 Ga0415639_157231_162_623 153
8 3300042550 Ga0466656_072970 Ga0466656_072970_823_1284 153
9 3300042592 Ga0466693_268105 Ga0466693_268105_222_683 153
10 3300042592 Ga0466693_349608 Ga0466693_349608_794_1255 153
11 3300042593 Ga0466691_025627 Ga0466691_025627_362_823 153
12 3300042593 Ga0466691_219786 Ga0466691_219786_814_1275 153
13 3300042594 Ga0466694_130300 Ga0466694_130300_226_687 153
14 3300042594 Ga0466694_146673 Ga0466694_146673_668_1129 153
15 3300042598 Ga0466701_015202 Ga0466701_015202_502_963 153
16 3300042598 Ga0466701_029062 Ga0466701_029062_2174_2635 153
17 3300042598 Ga0466701_047426 Ga0466701_047426_915_1376 153
18 3300042598 Ga0466701_064861 Ga0466701_064861_347_808 153
19 3300042598 Ga0466701_072830 Ga0466701_072830_886_1347 153
20 3300042598 Ga0466701_083131 Ga0466701_083131_824_1285 153
21 3300042598 Ga0466701_097728 Ga0466701_097728_617_1078 153
22 3300042600 Ga0466700_349245 Ga0466700_349245_390_851 153
23 3300042600 Ga0466700_373865 Ga0466700_373865_137_598 153
24 3300042600 Ga0466700_392844 Ga0466700_392844_55_516 153
25 3300042600 Ga0466700_443517 Ga0466700_443517_513_974 153
26 3300042604 Ga0466717_022823 Ga0466717_022823_379_840 153
27 3300042608 Ga0466721_329163 Ga0466721_329163_678_1139 153
28 3300042610 Ga0466698_336173 Ga0466698_336173_340_801 153
29 3300042611 Ga0466697_230419 Ga0466697_230419_276_737 153
30 3300042612 Ga0466705_383749 Ga0466705_383749_26388_26849 153
31 3300042613 Ga0466710_044592 Ga0466710_044592_691_1152 153
32 3300042617 Ga0466718_011460 Ga0466718_011460_1144_1605 153
33 3300042617 Ga0466718_074936 Ga0466718_074936_273_734 153
34 3300042617 Ga0466718_161653 Ga0466718_161653_789_1250 153
35 3300042618 Ga0466723_009217 Ga0466723_009217_577_1038 153
36 3300042620 Ga0466728_212165 Ga0466728_212165_2291_2752 153
37 3300042622 Ga0466731_223003 Ga0466731_223003_1051_1512 153
38 3300042623 Ga0466734_093883 Ga0466734_093883_172_633 153
39 3300042635 Ga0466702_096884 Ga0466702_096884_958_1419 153
40 3300042643 Ga0466704_252832 Ga0466704_252832_76_537 153
41 3300042649 Ga0466724_33287 Ga0466724_33287_156_617 153
42 3300042654 Ga0466725_061175 Ga0466725_061175_226_687 153
43 3300042654 Ga0466725_325473 Ga0466725_325473_526_987 153
44 3300042659 Ga0466733_206077 Ga0466733_206077_568_1029 153
45 iso_pr_bacteria 2820587002 2820588446 153
46 iso_pr_bacteria 2820690275 2820692165 153
47 3300002450 JGI24695J34938_10013286 JGI24695J34938_100132864 154
48 3300002450 JGI24695J34938_10049043 JGI24695J34938_100490433 154
49 3300002462 JGI24702J35022_10192349 JGI24702J35022_101923492 154
50 3300002462 JGI24702J35022_10218173 JGI24702J35022_102181731 154
51 3300002462 JGI24702J35022_10355360 JGI24702J35022_103553601 154
52 3300002462 JGI24702J35022_10425814 JGI24702J35022_104258141 154
53 3300002462 JGI24702J35022_10483535 JGI24702J35022_104835351 154
54 3300002504 JGI24705J35276_11838292 JGI24705J35276_118382922 154
55 3300002508 JGI24700J35501_10355497 JGI24700J35501_103554971 154
56 3300002834 JGI24696J40584_12911302 JGI24696J40584_129113021 154
57 3300005201 Ga0072941_1262486 Ga0072941_12624862 154
58 3300005485 Ga0074263_100622 Ga0074263_1006221 154
59 3300009826 Ga0123355_10003847 Ga0123355_1000384718 154
60 3300010049 Ga0123356_10431039 Ga0123356_104310391 154
61 3300010049 Ga0123356_10534086 Ga0123356_105340861 154
62 3300010049 Ga0123356_10898356 Ga0123356_108983562 154
63 3300010049 Ga0123356_11563382 Ga0123356_115633821 154
64 3300010049 Ga0123356_12542796 Ga0123356_125427961 154
65 3300010167 Ga0123353_10657762 Ga0123353_106577622 154
66 3300010167 Ga0123353_10783357 Ga0123353_107833571 154
67 3300010167 Ga0123353_11418245 Ga0123353_114182452 154
68 3300010167 Ga0123353_11451054 Ga0123353_114510541 154
69 3300010882 Ga0123354_10269678 Ga0123354_102696782 154
70 3300010882 Ga0123354_10349376 Ga0123354_103493762 154
71 3300042592 Ga0466693_029052 Ga0466693_029052_207_674 155
72 3300042592 Ga0466693_309653 Ga0466693_309653_776_1243 155
73 3300042592 Ga0466693_389680 Ga0466693_389680_285_752 155
74 3300042594 Ga0466694_235537 Ga0466694_235537_86_553 155
75 3300042595 Ga0466695_119537 Ga0466695_119537_16_483 155
76 3300042596 Ga0466696_073530 Ga0466696_073530_410_877 155
77 3300042596 Ga0466696_107964 Ga0466696_107964_257_724 155
78 3300042596 Ga0466696_142536 Ga0466696_142536_196_663 155
79 3300042596 Ga0466696_190597 Ga0466696_190597_69_536 155
80 3300042596 Ga0466696_192573 Ga0466696_192573_47_514 155
81 3300042596 Ga0466696_214146 Ga0466696_214146_830_1297 155
82 3300042604 Ga0466717_276440 Ga0466717_276440_799_1266 155
83 3300042604 Ga0466717_284382 Ga0466717_284382_226_693 155
84 3300042609 Ga0466722_126375 Ga0466722_126375_1307_1774 155
85 3300042609 Ga0466722_150886 Ga0466722_150886_2729_3196 155
86 3300042610 Ga0466698_052220 Ga0466698_052220_1525_1992 155
87 3300042616 Ga0466715_162482 Ga0466715_162482_638_1105 155
88 3300042618 Ga0466723_079592 Ga0466723_079592_2864_3331 155
89 3300042618 Ga0466723_096893 Ga0466723_096893_592_1059 155
90 3300042622 Ga0466731_035468 Ga0466731_035468_537_1004 155
91 3300042622 Ga0466731_386701 Ga0466731_386701_804_1271 155
92 3300042623 Ga0466734_096095 Ga0466734_096095_539_1006 155
93 3300042623 Ga0466734_162335 Ga0466734_162335_513_980 155
94 3300042643 Ga0466704_170250 Ga0466704_170250_5648_6115 155
95 3300042648 Ga0466709_399299 Ga0466709_399299_620_1087 155
96 3300002450 JGI24695J34938_10073326 JGI24695J34938_100733262 156
97 3300002504 JGI24705J35276_12048714 JGI24705J35276_120487142 156
98 3300005200 Ga0072940_1113562 Ga0072940_11135621 156
99 3300005201 Ga0072941_1134534 Ga0072941_11345341 156
100 3300009826 Ga0123355_10549300 Ga0123355_105493002 156
101 3300010049 Ga0123356_10168418 Ga0123356_101684183 156
102 3300010049 Ga0123356_10386128 Ga0123356_103861283 156
103 3300010049 Ga0123356_10716877 Ga0123356_107168772 156
104 3300010049 Ga0123356_10767043 Ga0123356_107670432 156
105 3300010167 Ga0123353_10365671 Ga0123353_103656712 156
106 3300010167 Ga0123353_10436556 Ga0123353_104365562 156
107 3300010167 Ga0123353_10686187 Ga0123353_106861872 156
108 3300010167 Ga0123353_10689245 Ga0123353_106892451 156
109 3300010167 Ga0123353_10772305 Ga0123353_107723052 156
110 3300010167 Ga0123353_11901181 Ga0123353_119011811 156
111 3300010167 Ga0123353_12143832 Ga0123353_121438321 156
112 3300010882 Ga0123354_10191214 Ga0123354_101912143 156
113 3300042611 Ga0466697_142000 Ga0466697_142000_527_997 156
114 3300042617 Ga0466718_075314 Ga0466718_075314_606_1079 157
115 3300042635 Ga0466702_003716 Ga0466702_003716_506_982 158
116 3300042659 Ga0466733_101890 Ga0466733_101890_897_1373 158
117 3300010049 Ga0123356_10376939 Ga0123356_103769392 163
118 3300042594 Ga0466694_133138 Ga0466694_133138_5003_5515 170
119 3300042596 Ga0466696_094981 Ga0466696_094981_228_788 186

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13551 HTH_29 Winged helix-turn helix 34 103 0.89
PF13565 HTH_32 Homeodomain-like domain 65 147 0.77

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.49 0.62 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.