Protein Family IF05128

Metagenome Isolate
204 Members
57 Samples
194 Scaffolds
223.91 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_082907|Ga0466696_082907_3457_4227
Length
256 aa
Sequence
MPAEEYSVDSNKRRSGQDKQDQTQNNLLKSSDMKFTKIQVLTAMQQTGLVPVYYNSDTATAKNVLKACYNGGIRAFEFTNRGDFAHEVFGELVKFAAKECPEMILGIGSIVESGSASLYIQLGANFVVGPSFNPDVAKICNRRLVPYTPGCGSVSEVGAAQEVGCDLCKVFPGDVLGPHFVKGLRAPMPWSMLMVTGGVKPEESNLKSWFDAGVTCVGMGSNLFPSDLVNAKNWDGITRLCSDTLAIIKKTRTSGQ

📊 Sample Types

Isolate 4.9%
Metagenome 95.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.1%
Kalotermitidae 25.0%
Blattidae 12.5%
Unclassified 8.9%
Rhinotermitidae 7.1%
Termopsidae 7.1%
Passalidae 5.4%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 193
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
11 2920168565 Paludibacter sp. 221 Isolate Blattidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
14 2922326829 Bacteroides sp. 224 Isolate Blattidae
15 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
26 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
33 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
34 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
35 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
40 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
41 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
50 3004672520 Bacteroides sp. 51 Isolate Blattidae
51 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
52 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
53 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
56 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
57 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_133856 3300042611 Bacteria 1899
2 Ga0466697_179409 3300042611 Bacteria 152612
3 Ga0466706_085050 3300042599 Bacteria 34505
4 Ga0466707_065891 3300042601 Bacteria 6593
5 Ga0466713_073291 3300042602 Bacteria 42324
6 Ga0466713_077572 3300042602 Bacteria 13878
7 Ga0466714_006646 3300042603 Bacteria 2665
8 Ga0466716_210934 3300042605 Bacteria 22432
9 Ga0466719_069723 3300042606 Bacteria 1569
10 Ga0123356_11183700 3300010049 Bacteria 931
11 Ga0123353_10051919 3300010167 Bacteria 6545
12 Ga0123353_10194288 3300010167 Bacteria 3200
13 Ga0466712_268526 3300042614 Bacteria 2363
14 Ga0466723_023862 3300042618 Bacteria 63714
15 Ga0466723_030624 3300042618 Bacteria 7963
16 Ga0466726_117919 3300042619 Bacteria 12892
17 Ga0265387_1000217 3300024582 Bacteria 10028
18 Ga0415639_004716 3300038395 Unclassified 2199
19 Ga0466690_087584 3300042590 Bacteria 2236
20 Ga0466691_203953 3300042593 Bacteria 6505
21 Ga0466696_035748 3300042596 Bacteria 10479
22 Ga0466696_167826 3300042596 Bacteria 25872
23 Ga0466696_230918 3300042596 Bacteria 7431
24 Ga0466703_304167 3300042636 Bacteria 2991
25 Ga0466708_141991 3300042652 Bacteria 46886
26 Ga0466725_209256 3300042654 Bacteria 1161
27 Ga0466725_211683 3300042654 Bacteria 11769
28 IMNBL1DRAFT_c0025120 3300000062 Unclassified 2291
29 Ga0068302_10158787 3300005071 Unclassified 2186
30 Ga0466705_019478 3300042612 Bacteria 1038
31 Ga0466733_004056 3300042659 Bacteria 4976
32 Ga0466706_017038 3300042599 Bacteria 50770
33 Ga0466706_036009 3300042599 Bacteria 4788
34 Ga0466713_028347 3300042602 Bacteria 9092
35 Ga0466713_038658 3300042602 Bacteria 11743
36 Ga0466713_063807 3300042602 Bacteria 6440
37 Ga0466713_091524 3300042602 Bacteria 31228
38 Ga0466714_020636 3300042603 Bacteria 1874
39 Ga0466716_139527 3300042605 Bacteria 30382
40 Ga0466719_235063 3300042606 Bacteria 1551
41 Ga0466698_140456 3300042610 Bacteria 4387
42 Ga0123357_10286656 3300009784 Bacteria 1690
43 Ga0123356_10403646 3300010049 Bacteria 1505
44 Ga0466705_520303 3300042612 Bacteria 1032
45 Ga0466715_232351 3300042616 Bacteria 13419
46 Ga0466718_145752 3300042617 Bacteria 1125
47 Ga0466723_088540 3300042618 Bacteria 24372
48 Ga0466690_041120 3300042590 Bacteria 21497
49 Ga0466690_241549 3300042590 Bacteria 6321
50 Ga0466692_023160 3300042591 Bacteria 9066
51 Ga0466696_165047 3300042596 Bacteria 4624
52 Ga0466735_004567 3300042624 Bacteria 1638
53 Ga0466735_031903 3300042624 Bacteria 1762
54 Ga0466735_040128 3300042624 Bacteria 1182
55 Ga0466735_144367 3300042624 Bacteria 2166
56 Ga0466727_294554 3300042655 Bacteria 5026
57 2227530172 2225789004 Bacteria 16460
58 IMNBL1DRAFT_c0002572 3300000062 Bacteria 12503
59 JGI24695J34938_10089272 3300002450 Bacteria 1266
60 Ga0068302_10014307 3300005071 Bacteria 12890
61 Ga0466706_055883 3300042599 Bacteria 5103
62 Ga0466713_029016 3300042602 Bacteria 1959
63 Ga0466713_121905 3300042602 Bacteria 15307
64 Ga0466714_148962 3300042603 Unclassified 1245
65 Ga0466714_157561 3300042603 Bacteria 10125
66 Ga0466719_131565 3300042606 Bacteria 6872
67 Ga0466722_139145 3300042609 Bacteria 3688
68 Ga0123356_10243329 3300010049 Bacteria 1871
69 Ga0123353_10369808 3300010167 Bacteria 2150
70 Ga0466711_027826 3300042615 Bacteria 7078
71 Ga0466715_040739 3300042616 Bacteria 29108
72 Ga0466723_168825 3300042618 Bacteria 24885
73 Ga0466723_183847 3300042618 Bacteria 12292
74 Ga0466723_221683 3300042618 Bacteria 3344
75 Ga0466728_119729 3300042620 Bacteria 13479
76 Ga0466690_291376 3300042590 Bacteria 7530
77 Ga0466703_315169 3300042636 Bacteria 3885
78 Ga0466704_215711 3300042643 Bacteria 2093
79 2227069685 2225789003 Bacteria 13369
80 JGI24702J35022_10000876 3300002462 Bacteria 18643
81 JGI24702J35022_10006255 3300002462 Bacteria 6889
82 JGI24702J35022_10016621 3300002462 Bacteria 4031
83 Ga0068305_10038085 3300005083 Bacteria 18850
84 Ga0466733_218157 3300042659 Bacteria 2712
85 Ga0466701_059539 3300042598 Bacteria 71898
86 Ga0466706_025114 3300042599 Bacteria 2064
87 Ga0466706_211737 3300042599 Bacteria 1682
88 Ga0466706_250156 3300042599 Bacteria 11504
89 Ga0466714_006756 3300042603 Bacteria 211810
90 Ga0466722_042520 3300042609 Bacteria 9397
91 Ga0123353_10108930 3300010167 Bacteria 4463
92 Ga0123354_10173318 3300010882 Bacteria 2499
93 Ga0466710_020446 3300042613 Bacteria 1230
94 Ga0466711_405589 3300042615 Bacteria 4266
95 Ga0466715_242562 3300042616 Bacteria 39443
96 Ga0466726_155838 3300042619 Bacteria 18951
97 Ga0466728_087702 3300042620 Bacteria 35663
98 Ga0466696_181868 3300042596 Bacteria 6179
99 Ga0466696_230688 3300042596 Bacteria 36968
100 Ga0466704_054440 3300042643 Bacteria 16809
101 Ga0466709_336303 3300042648 Bacteria 2365
102 Ga0466708_231449 3300042652 Bacteria 7016
103 Ga0466708_293118 3300042652 Bacteria 9389
104 Ga0466719_021140 3300042606 Bacteria 5135
105 Ga0123356_10040032 3300010049 Bacteria 4367
106 Ga0123354_10092569 3300010882 Bacteria 4163
107 Ga0466710_146784 3300042613 Bacteria 1717
108 Ga0466711_468146 3300042615 Bacteria 29475
109 Ga0466726_458032 3300042619 Bacteria 1853
110 Ga0466729_019787 3300042621 Bacteria 1627
111 Ga0466690_035455 3300042590 Bacteria 5420
112 Ga0466690_066024 3300042590 Bacteria 3029
113 Ga0466692_100658 3300042591 Bacteria 10980
114 Ga0466696_043029 3300042596 Bacteria 6070
115 Ga0466735_001680 3300042624 Bacteria 2727
116 Ga0466735_061328 3300042624 Unclassified 1431
117 Ga0466735_128324 3300042624 Unclassified 1555
118 Ga0466735_223431 3300042624 Bacteria 1530
119 Ga0466703_122833 3300042636 Bacteria 5687
120 Ga0466708_170694 3300042652 Bacteria 1066
121 2227273572 2225789004 Unclassified 1273
122 2227519087 2225789004 Bacteria 17332
123 2227530164 2225789004 Bacteria 16506
124 JGI24702J35022_10128828 3300002462 Bacteria 1403
125 Ga0068302_10446336 3300005071 Bacteria 1387
126 Ga0068305_10106944 3300005083 Bacteria 5176
127 Ga0466707_259090 3300042601 Bacteria 2451
128 Ga0466713_116299 3300042602 Bacteria 1842
129 Ga0466716_199903 3300042605 Bacteria 5808
130 Ga0466716_544085 3300042605 Bacteria 17149
131 Ga0123356_10135251 3300010049 Bacteria 2422
132 Ga0123356_11203288 3300010049 Bacteria 924
133 Ga0466711_308404 3300042615 Bacteria 17331
134 Ga0466711_392680 3300042615 Bacteria 13459
135 Ga0466715_407960 3300042616 Bacteria 6940
136 Ga0466726_415753 3300042619 Bacteria 3581
137 Ga0466728_362487 3300042620 Bacteria 4663
138 Ga0466690_126533 3300042590 Bacteria 1201
139 Ga0466691_006306 3300042593 Bacteria 3827
140 Ga0466696_082907 3300042596 Bacteria 4944
141 Ga0466735_147561 3300042624 Bacteria 1100
142 Ga0466704_084077 3300042643 Bacteria 17157
143 Ga0466704_421307 3300042643 Bacteria 4486
144 Ga0466727_053371 3300042655 Bacteria 10852
145 Ga0466727_145522 3300042655 Bacteria 16431
146 IMNBL1DRAFT_c0013990 3300000062 Bacteria 3567
147 IMNBL1DRAFT_c0042269 3300000062 Bacteria 1521
148 Ga0068305_10007041 3300005083 Bacteria 12442
149 Ga0466705_260081 3300042612 Bacteria 7919
150 Ga0466705_326516 3300042612 Bacteria 6288
151 Ga0466733_199272 3300042659 Bacteria 7313
152 Ga0466707_002063 3300042601 Bacteria 2797
153 Ga0466713_042598 3300042602 Bacteria 13134
154 Ga0466716_486782 3300042605 Bacteria 3093
155 Ga0466719_079794 3300042606 Bacteria 11280
156 Ga0466722_178165 3300042609 Bacteria 29947
157 Ga0123353_10091418 3300010167 Bacteria 4902
158 Ga0466711_517412 3300042615 Bacteria 12377
159 Ga0466715_220301 3300042616 Bacteria 20393
160 Ga0466690_186184 3300042590 Bacteria 2122
161 Ga0466703_116500 3300042636 Bacteria 4619
162 Ga0466704_376819 3300042643 Bacteria 49548
163 Ga0466709_055818 3300042648 Bacteria 52555
164 Ga0466709_226061 3300042648 Bacteria 3918
165 Ga0466708_208353 3300042652 Bacteria 3073
166 2227485471 2225789004 Bacteria 4268
167 IMNBL1DRAFT_c0001348 3300000062 Bacteria 18506
168 IMNBL1DRAFT_c0002077 3300000062 Unclassified 14281
169 IMNBL1DRAFT_c0088258 3300000062 Bacteria 855
170 JGI24702J35022_10369989 3300002462 Bacteria 860
171 Ga0466705_140360 3300042612 Bacteria 13000
172 Ga0466733_117251 3300042659 Bacteria 91507
173 Ga0466733_131889 3300042659 Bacteria 9326
174 Ga0466733_215504 3300042659 Bacteria 1940
175 Ga0466706_236412 3300042599 Bacteria 28792
176 Ga0466713_025355 3300042602 Bacteria 7532
177 Ga0123353_10159842 3300010167 Bacteria 3588
178 Ga0123353_10777544 3300010167 Bacteria 1327
179 Ga0123354_10180102 3300010882 Bacteria 2417
180 Ga0466705_476341 3300042612 Bacteria 12361
181 Ga0466715_049724 3300042616 Bacteria 14178
182 Ga0466726_410350 3300042619 Bacteria 6589
183 Ga0466657_178383 3300042582 Unclassified 5730
184 Ga0466690_018339 3300042590 Bacteria 7473
185 Ga0466690_090392 3300042590 Bacteria 1266
186 Ga0466693_050116 3300042592 Bacteria 1810
187 Ga0466691_039676 3300042593 Unclassified 12508
188 Ga0466691_223859 3300042593 Bacteria 26799
189 Ga0466696_124994 3300042596 Bacteria 7307
190 Ga0466729_275873 3300042621 Bacteria 4294
191 Ga0466703_070152 3300042636 Bacteria 6480
192 Ga0466708_246063 3300042652 Bacteria 25365
193 Ga0466727_083717 3300042655 Bacteria 8189
194 Ga0068302_10216216 3300005071 Unclassified 4484

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042620 Ga0466728_119729 Ga0466728_119729_6826_7446 206
2 3300042596 Ga0466696_230688 Ga0466696_230688_34228_34851 207
3 3300042603 Ga0466714_148962 Ga0466714_148962_590_1225 211
4 3300042612 Ga0466705_520303 Ga0466705_520303_364_999 211
5 3300042652 Ga0466708_231449 Ga0466708_231449_347_982 211
6 3300042603 Ga0466714_020636 Ga0466714_020636_50_688 212
7 3300042616 Ga0466715_220301 Ga0466715_220301_7746_8399 217
8 3300005071 Ga0068302_10216216 Ga0068302_102162163 220
9 3300042602 Ga0466713_116299 Ga0466713_116299_51_713 220
10 3300042616 Ga0466715_242562 Ga0466715_242562_29025_29687 220
11 3300042619 Ga0466726_155838 Ga0466726_155838_14121_14783 220
12 3300005071 Ga0068302_10014307 Ga0068302_100143072 221
13 3300010049 Ga0123356_10135251 Ga0123356_101352512 221
14 3300042599 Ga0466706_236412 Ga0466706_236412_22644_23309 221
15 3300042602 Ga0466713_077572 Ga0466713_077572_5469_6134 221
16 3300000062 IMNBL1DRAFT_c0013990 IMNBL1DRAFT_00139903 222
17 3300000062 IMNBL1DRAFT_c0042269 IMNBL1DRAFT_00422692 222
18 3300042591 Ga0466692_100658 Ga0466692_100658_9210_9878 222
19 3300042598 Ga0466701_059539 Ga0466701_059539_15030_15698 222
20 3300042599 Ga0466706_017038 Ga0466706_017038_17742_18410 222
21 3300042599 Ga0466706_036009 Ga0466706_036009_2043_2711 222
22 3300042602 Ga0466713_025355 Ga0466713_025355_5395_6063 222
23 3300042602 Ga0466713_038658 Ga0466713_038658_9238_9906 222
24 3300042602 Ga0466713_042598 Ga0466713_042598_2848_3516 222
25 3300042603 Ga0466714_006756 Ga0466714_006756_794_1462 222
26 3300042603 Ga0466714_157561 Ga0466714_157561_9166_9834 222
27 3300042606 Ga0466719_079794 Ga0466719_079794_5909_6577 222
28 3300042612 Ga0466705_326516 Ga0466705_326516_2101_2769 222
29 3300042613 Ga0466710_146784 Ga0466710_146784_481_1149 222
30 3300042614 Ga0466712_268526 Ga0466712_268526_1423_2091 222
31 3300042619 Ga0466726_415753 Ga0466726_415753_983_1651 222
32 3300042624 Ga0466735_061328 Ga0466735_061328_555_1223 222
33 3300042624 Ga0466735_144367 Ga0466735_144367_827_1495 222
34 3300042643 Ga0466704_084077 Ga0466704_084077_7403_8071 222
35 3300042643 Ga0466704_215711 Ga0466704_215711_1023_1691 222
36 3300042643 Ga0466704_376819 Ga0466704_376819_14057_14725 222
37 3300042652 Ga0466708_141991 Ga0466708_141991_11887_12555 222
38 3300042655 Ga0466727_083717 Ga0466727_083717_3575_4243 222
39 3300042659 Ga0466733_004056 Ga0466733_004056_474_1142 222
40 3300042659 Ga0466733_131889 Ga0466733_131889_1670_2338 222
41 3300042659 Ga0466733_218157 Ga0466733_218157_1905_2573 222
42 iso_pr_bacteria 2920168565 2920170076 222
43 iso_pr_bacteria 2940199050 2940200981 222
44 iso_pr_bacteria 2940202316 2940204636 222
45 iso_pr_bacteria 2940209341 2940212017 222
46 iso_pr_bacteria 2940346213 2940347634 222
47 2225789004 2227485471 2227950858 223
48 2225789004 2227519087 2228020761 223
49 3300005083 Ga0068305_10038085 Ga0068305_1003808525 223
50 3300005083 Ga0068305_10106944 Ga0068305_101069444 223
51 3300010882 Ga0123354_10173318 Ga0123354_101733183 223
52 3300024582 Ga0265387_1000217 Ga0265387_10002173 223
53 3300038395 Ga0415639_004716 Ga0415639_004716_1009_1680 223
54 3300042582 Ga0466657_178383 Ga0466657_178383_1359_2030 223
55 3300042590 Ga0466690_035455 Ga0466690_035455_740_1411 223
56 3300042590 Ga0466690_087584 Ga0466690_087584_603_1274 223
57 3300042590 Ga0466690_090392 Ga0466690_090392_464_1135 223
58 3300042590 Ga0466690_126533 Ga0466690_126533_193_864 223
59 3300042590 Ga0466690_291376 Ga0466690_291376_4591_5262 223
60 3300042593 Ga0466691_006306 Ga0466691_006306_3125_3796 223
61 3300042593 Ga0466691_039676 Ga0466691_039676_11119_11790 223
62 3300042596 Ga0466696_124994 Ga0466696_124994_5136_5807 223
63 3300042596 Ga0466696_167826 Ga0466696_167826_14644_15315 223
64 3300042596 Ga0466696_230918 Ga0466696_230918_784_1455 223
65 3300042599 Ga0466706_025114 Ga0466706_025114_1274_1945 223
66 3300042599 Ga0466706_055883 Ga0466706_055883_2553_3224 223
67 3300042599 Ga0466706_085050 Ga0466706_085050_15545_16216 223
68 3300042599 Ga0466706_211737 Ga0466706_211737_770_1441 223
69 3300042599 Ga0466706_250156 Ga0466706_250156_778_1449 223
70 3300042602 Ga0466713_063807 Ga0466713_063807_5044_5715 223
71 3300042602 Ga0466713_091524 Ga0466713_091524_12999_13670 223
72 3300042602 Ga0466713_121905 Ga0466713_121905_13309_13980 223
73 3300042603 Ga0466714_006646 Ga0466714_006646_617_1288 223
74 3300042605 Ga0466716_210934 Ga0466716_210934_13492_14163 223
75 3300042605 Ga0466716_544085 Ga0466716_544085_14847_15518 223
76 3300042606 Ga0466719_021140 Ga0466719_021140_169_840 223
77 3300042606 Ga0466719_069723 Ga0466719_069723_755_1426 223
78 3300042606 Ga0466719_131565 Ga0466719_131565_593_1264 223
79 3300042610 Ga0466698_140456 Ga0466698_140456_3580_4251 223
80 3300042611 Ga0466697_133856 Ga0466697_133856_27_698 223
81 3300042612 Ga0466705_019478 Ga0466705_019478_280_951 223
82 3300042612 Ga0466705_140360 Ga0466705_140360_1784_2455 223
83 3300042612 Ga0466705_260081 Ga0466705_260081_3610_4281 223
84 3300042612 Ga0466705_476341 Ga0466705_476341_6515_7186 223
85 3300042613 Ga0466710_020446 Ga0466710_020446_498_1169 223
86 3300042615 Ga0466711_517412 Ga0466711_517412_5887_6558 223
87 3300042616 Ga0466715_232351 Ga0466715_232351_7132_7803 223
88 3300042617 Ga0466718_145752 Ga0466718_145752_303_974 223
89 3300042618 Ga0466723_088540 Ga0466723_088540_12063_12734 223
90 3300042618 Ga0466723_168825 Ga0466723_168825_20612_21283 223
91 3300042618 Ga0466723_183847 Ga0466723_183847_1387_2058 223
92 3300042619 Ga0466726_410350 Ga0466726_410350_4240_4911 223
93 3300042620 Ga0466728_087702 Ga0466728_087702_30758_31429 223
94 3300042620 Ga0466728_362487 Ga0466728_362487_3115_3786 223
95 3300042624 Ga0466735_031903 Ga0466735_031903_209_880 223
96 3300042624 Ga0466735_147561 Ga0466735_147561_258_929 223
97 3300042636 Ga0466703_304167 Ga0466703_304167_1483_2154 223
98 3300042643 Ga0466704_054440 Ga0466704_054440_12410_13081 223
99 3300042648 Ga0466709_055818 Ga0466709_055818_634_1305 223
100 3300042648 Ga0466709_226061 Ga0466709_226061_2556_3227 223
101 3300042652 Ga0466708_170694 Ga0466708_170694_188_859 223
102 3300042652 Ga0466708_208353 Ga0466708_208353_240_911 223
103 3300042652 Ga0466708_246063 Ga0466708_246063_18988_19659 223
104 3300042654 Ga0466725_209256 Ga0466725_209256_309_980 223
105 3300042655 Ga0466727_053371 Ga0466727_053371_5044_5715 223
106 3300042659 Ga0466733_117251 Ga0466733_117251_9471_10142 223
107 3300042659 Ga0466733_199272 Ga0466733_199272_3806_4477 223
108 3300042659 Ga0466733_215504 Ga0466733_215504_914_1585 223
109 iso_pr_bacteria 2820746860 2820748302 223
110 iso_pr_bacteria 2922326829 2922330173 223
111 iso_pr_bacteria 3004672520 3004674354 223
112 2225789003 2227069685 2227430462 224
113 2225789004 2227273572 2227723379 224
114 2225789004 2227530172 2228041482 224
115 3300000062 IMNBL1DRAFT_c0001348 IMNBL1DRAFT_00013481 224
116 3300000062 IMNBL1DRAFT_c0002077 IMNBL1DRAFT_00020773 224
117 3300000062 IMNBL1DRAFT_c0002572 IMNBL1DRAFT_00025727 224
118 3300000062 IMNBL1DRAFT_c0088258 IMNBL1DRAFT_00882581 224
119 3300002450 JGI24695J34938_10089272 JGI24695J34938_100892722 224
120 3300002462 JGI24702J35022_10000876 JGI24702J35022_100008767 224
121 3300002462 JGI24702J35022_10016621 JGI24702J35022_100166212 224
122 3300002462 JGI24702J35022_10128828 JGI24702J35022_101288281 224
123 3300002462 JGI24702J35022_10369989 JGI24702J35022_103699891 224
124 3300005071 Ga0068302_10158787 Ga0068302_101587872 224
125 3300010049 Ga0123356_10040032 Ga0123356_100400324 224
126 3300010049 Ga0123356_10243329 Ga0123356_102433292 224
127 3300010049 Ga0123356_10403646 Ga0123356_104036462 224
128 3300010049 Ga0123356_11203288 Ga0123356_112032882 224
129 3300010167 Ga0123353_10108930 Ga0123353_101089302 224
130 3300010167 Ga0123353_10159842 Ga0123353_101598423 224
131 3300010167 Ga0123353_10369808 Ga0123353_103698082 224
132 3300010167 Ga0123353_10777544 Ga0123353_107775442 224
133 3300010882 Ga0123354_10180102 Ga0123354_101801022 224
134 3300042590 Ga0466690_018339 Ga0466690_018339_555_1229 224
135 3300042590 Ga0466690_041120 Ga0466690_041120_8227_8901 224
136 3300042590 Ga0466690_066024 Ga0466690_066024_1624_2298 224
137 3300042590 Ga0466690_186184 Ga0466690_186184_1006_1680 224
138 3300042591 Ga0466692_023160 Ga0466692_023160_5178_5852 224
139 3300042593 Ga0466691_203953 Ga0466691_203953_4414_5088 224
140 3300042593 Ga0466691_223859 Ga0466691_223859_25073_25747 224
141 3300042602 Ga0466713_028347 Ga0466713_028347_7247_7921 224
142 3300042602 Ga0466713_029016 Ga0466713_029016_567_1241 224
143 3300042605 Ga0466716_139527 Ga0466716_139527_2010_2684 224
144 3300042605 Ga0466716_199903 Ga0466716_199903_976_1650 224
145 3300042606 Ga0466719_235063 Ga0466719_235063_372_1046 224
146 3300042615 Ga0466711_027826 Ga0466711_027826_3498_4172 224
147 3300042615 Ga0466711_308404 Ga0466711_308404_10223_10897 224
148 3300042615 Ga0466711_392680 Ga0466711_392680_11689_12363 224
149 3300042616 Ga0466715_040739 Ga0466715_040739_11450_12124 224
150 3300042616 Ga0466715_049724 Ga0466715_049724_1709_2383 224
151 3300042616 Ga0466715_407960 Ga0466715_407960_3740_4414 224
152 3300042618 Ga0466723_023862 Ga0466723_023862_12009_12683 224
153 3300042618 Ga0466723_030624 Ga0466723_030624_5532_6206 224
154 3300042621 Ga0466729_275873 Ga0466729_275873_1561_2235 224
155 3300042624 Ga0466735_004567 Ga0466735_004567_466_1140 224
156 3300042636 Ga0466703_116500 Ga0466703_116500_2762_3436 224
157 3300042636 Ga0466703_315169 Ga0466703_315169_3034_3708 224
158 3300042643 Ga0466704_421307 Ga0466704_421307_1180_1854 224
159 3300042648 Ga0466709_336303 Ga0466709_336303_1429_2103 224
160 3300042652 Ga0466708_293118 Ga0466708_293118_7387_8061 224
161 iso_pr_bacteria 2695420317 2695485990 224
162 iso_pr_bacteria 8100157865 8100161402 224
163 3300000062 IMNBL1DRAFT_c0025120 IMNBL1DRAFT_00251202 225
164 3300005071 Ga0068302_10446336 Ga0068302_104463362 225
165 3300005083 Ga0068305_10007041 Ga0068305_100070419 225
166 3300010049 Ga0123356_11183700 Ga0123356_111837001 225
167 3300010167 Ga0123353_10051919 Ga0123353_100519194 225
168 3300010167 Ga0123353_10194288 Ga0123353_101942882 225
169 3300010882 Ga0123354_10092569 Ga0123354_100925694 225
170 3300042590 Ga0466690_241549 Ga0466690_241549_3476_4153 225
171 3300042601 Ga0466707_259090 Ga0466707_259090_54_731 225
172 3300042605 Ga0466716_486782 Ga0466716_486782_2226_2903 225
173 3300042609 Ga0466722_042520 Ga0466722_042520_7039_7716 225
174 3300042611 Ga0466697_179409 Ga0466697_179409_55789_56466 225
175 3300042615 Ga0466711_468146 Ga0466711_468146_1456_2133 225
176 3300042619 Ga0466726_117919 Ga0466726_117919_1187_1864 225
177 3300042619 Ga0466726_458032 Ga0466726_458032_269_946 225
178 3300042636 Ga0466703_070152 Ga0466703_070152_4225_4902 225
179 3300042655 Ga0466727_145522 Ga0466727_145522_13590_14267 225
180 3300042655 Ga0466727_294554 Ga0466727_294554_2243_2920 225
181 3300002462 JGI24702J35022_10006255 JGI24702J35022_100062554 226
182 3300042596 Ga0466696_035748 Ga0466696_035748_9415_10095 226
183 3300042596 Ga0466696_043029 Ga0466696_043029_2963_3643 226
184 3300042596 Ga0466696_165047 Ga0466696_165047_3819_4499 226
185 3300042609 Ga0466722_139145 Ga0466722_139145_2303_2983 226
186 3300010167 Ga0123353_10091418 Ga0123353_100914182 227
187 3300042602 Ga0466713_073291 Ga0466713_073291_27081_27764 227
188 3300042621 Ga0466729_019787 Ga0466729_019787_491_1174 227
189 3300042624 Ga0466735_040128 Ga0466735_040128_316_999 227
190 3300009784 Ga0123357_10286656 Ga0123357_102866562 228
191 3300042596 Ga0466696_181868 Ga0466696_181868_4110_4796 228
192 3300042615 Ga0466711_405589 Ga0466711_405589_1086_1772 228
193 3300042601 Ga0466707_065891 Ga0466707_065891_1114_1803 229
194 3300042624 Ga0466735_128324 Ga0466735_128324_416_1105 229
195 3300042624 Ga0466735_223431 Ga0466735_223431_726_1415 229
196 3300042636 Ga0466703_122833 Ga0466703_122833_1463_2155 230
197 3300042624 Ga0466735_001680 Ga0466735_001680_1048_1752 234
198 2225789004 2227530164 2228041349 236
199 3300042609 Ga0466722_178165 Ga0466722_178165_26453_27166 237
200 3300042654 Ga0466725_211683 Ga0466725_211683_10759_11472 237
201 3300042601 Ga0466707_002063 Ga0466707_002063_566_1288 240
202 3300042618 Ga0466723_221683 Ga0466723_221683_97_819 240
203 3300042596 Ga0466696_082907 Ga0466696_082907_3457_4227 256
204 3300042592 Ga0466693_050116 Ga0466693_050116_476_1285 269

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01081 Aldolase KDPG and KHG aldolase 43 240 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01081 GO:0016829 lyase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.