Protein Family IF05119

Metagenome Isolate
110 Members
36 Samples
108 Scaffolds
178.71 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_067990|Ga0466696_067990_2028_2687
Length
202 aa
Sequence
MEKIYAFILFCVISGALVSKLRKMIEYIRGEIAELSPTQMVMECSGIGYELNISLTTYSAFNGRKEGKIYVYEVIREDAHLLFGFATREERELFLLLTSVSGVGPNTARMILSSLPPSELIRVIASGDDVSDLRNKVRSVEGQAEKESFAPGGRSETAEGAVAALIMLGFQKTASQKAVASVLKKTPSGTVEQVIKDALKIL

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 40.0%
Termitidae 20.0%
Unclassified 11.4%
Rhinotermitidae 8.6%
Termopsidae 8.6%
Passalidae 5.7%
Hodotermitidae 2.9%
Blattidae 2.9%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_299363 3300042615 Bacteria 8994
2 Ga0466723_046684 3300042618 Bacteria 8856
3 Ga0466723_250414 3300042618 Bacteria 18038
4 Ga0466726_232707 3300042619 Bacteria 5551
5 Ga0466691_226692 3300042593 Bacteria 4013
6 Ga0466729_197205 3300042621 Bacteria 3912
7 Ga0466735_124435 3300042624 Bacteria 1676
8 Ga0466735_159949 3300042624 Bacteria 1365
9 Ga0466703_016679 3300042636 Bacteria 25517
10 Ga0466708_058687 3300042652 Bacteria 40531
11 Ga0466725_311063 3300042654 Bacteria 6623
12 Ga0466707_065452 3300042601 Bacteria 19428
13 Ga0466719_066426 3300042606 Bacteria 3132
14 Ga0466715_521568 3300042616 Bacteria 1640
15 Ga0466728_244432 3300042620 Bacteria 30862
16 Ga0466728_324718 3300042620 Bacteria 11803
17 Ga0466690_090860 3300042590 Bacteria 14173
18 Ga0466690_247613 3300042590 Bacteria 6308
19 Ga0466691_032873 3300042593 Bacteria 12318
20 Ga0466696_260879 3300042596 Bacteria 16014
21 Ga0466696_349271 3300042596 Bacteria 17418
22 Ga0466696_464266 3300042596 Bacteria 5388
23 Ga0466703_120109 3300042636 Bacteria 10935
24 Ga0123356_10986466 3300010049 Bacteria 1013
25 Ga0466713_015150 3300042602 Bacteria 25600
26 Ga0466716_448089 3300042605 Bacteria 8967
27 Ga0466722_231624 3300042609 Bacteria 3198
28 IMNBL1DRAFT_c0000789 3300000062 Bacteria 24969
29 Ga0466733_030534 3300042659 Bacteria 73502
30 Ga0466715_112803 3300042616 Bacteria 21784
31 Ga0466728_211840 3300042620 Bacteria 17235
32 Ga0466728_332643 3300042620 Bacteria 3872
33 Ga0466692_047378 3300042591 Bacteria 93081
34 Ga0466696_008129 3300042596 Bacteria 20872
35 Ga0466696_285470 3300042596 Bacteria 9607
36 Ga0466735_223553 3300042624 Bacteria 1112
37 Ga0466704_096470 3300042643 Bacteria 3788
38 Ga0466704_111547 3300042643 Bacteria 3240
39 Ga0466704_266456 3300042643 Bacteria 15104
40 Ga0123353_10086853 3300010167 Bacteria 5038
41 Ga0466706_096605 3300042599 Bacteria 26851
42 Ga0466713_155527 3300042602 Bacteria 13847
43 2227154967 2225789004 Bacteria 1574
44 Ga0068305_10026751 3300005083 Bacteria 5845
45 Ga0466711_015732 3300042615 Bacteria 22229
46 Ga0466711_042944 3300042615 Bacteria 8482
47 Ga0466711_405975 3300042615 Bacteria 10553
48 Ga0466704_147620 3300042643 Bacteria 1274
49 Ga0466708_149614 3300042652 Bacteria 33318
50 Ga0123353_11087972 3300010167 Bacteria 1063
51 Ga0466722_117304 3300042609 Bacteria 122884
52 JGI24702J35022_10000101 3300002462 Bacteria 39658
53 JGI24702J35022_10041822 3300002462 Bacteria 2442
54 Ga0068302_10042514 3300005071 Bacteria 3928
55 Ga0466705_202820 3300042612 Bacteria 8538
56 Ga0466705_409747 3300042612 Bacteria 8638
57 Ga0466711_037484 3300042615 Bacteria 11494
58 Ga0466711_253863 3300042615 Bacteria 2692
59 Ga0466690_408081 3300042590 Bacteria 7594
60 Ga0466692_109656 3300042591 Bacteria 13674
61 Ga0466691_005537 3300042593 Unclassified 8388
62 Ga0466691_091910 3300042593 Bacteria 7343
63 Ga0466696_069019 3300042596 Bacteria 4554
64 Ga0466704_147750 3300042643 Bacteria 1154
65 Ga0466704_365178 3300042643 Bacteria 29867
66 Ga0466713_099964 3300042602 Bacteria 24145
67 Ga0068302_10247025 3300005071 Bacteria 1080
68 Ga0466697_197696 3300042611 Bacteria 22639
69 Ga0466705_315203 3300042612 Bacteria 4354
70 Ga0466705_388238 3300042612 Bacteria 26017
71 Ga0466715_049725 3300042616 Bacteria 2254
72 Ga0466715_064135 3300042616 Bacteria 2924
73 Ga0466726_231088 3300042619 Unclassified 9333
74 Ga0466728_109044 3300042620 Bacteria 2176
75 Ga0466691_015647 3300042593 Bacteria 10831
76 Ga0466696_051840 3300042596 Bacteria 26856
77 Ga0466735_005335 3300042624 Bacteria 1146
78 Ga0466708_081429 3300042652 Bacteria 11682
79 Ga0123356_10895373 3300010049 Bacteria 1059
80 Ga0466716_183262 3300042605 Bacteria 30600
81 JGI24702J35022_10003718 3300002462 Bacteria 9170
82 Ga0068305_10008962 3300005083 Bacteria 12406
83 Ga0466705_449119 3300042612 Bacteria 27557
84 Ga0466715_317832 3300042616 Bacteria 1101
85 Ga0466723_299222 3300042618 Bacteria 28350
86 Ga0466690_350935 3300042590 Bacteria 1008
87 Ga0466708_264419 3300042652 Bacteria 49465
88 Ga0123353_10760779 3300010167 Bacteria 1346
89 Ga0466722_217984 3300042609 Bacteria 3502
90 2227313850 2225789004 Bacteria 1200
91 IMNBL1DRAFT_c0008392 3300000062 Unclassified 5264
92 JGI24702J35022_10200198 3300002462 Bacteria 1143
93 Ga0072941_1081145 3300005201 Bacteria 9768
94 Ga0466705_006462 3300042612 Bacteria 1745
95 Ga0466711_472730 3300042615 Bacteria 12402
96 Ga0466693_148862 3300042592 Bacteria 2712
97 Ga0466691_005344 3300042593 Bacteria 6347
98 Ga0466691_195041 3300042593 Bacteria 1306
99 Ga0466696_067990 3300042596 Bacteria 2707
100 Ga0466703_104748 3300042636 Bacteria 7412
101 Ga0466704_388102 3300042643 Bacteria 9893
102 Ga0466704_406078 3300042643 Bacteria 12910
103 Ga0466709_127340 3300042648 Bacteria 4907
104 Ga0123353_10025707 3300010167 Bacteria 8977
105 Ga0466707_089583 3300042601 Bacteria 4464
106 Ga0466716_061134 3300042605 Bacteria 7887
107 2227222487 2225789004 Bacteria 7449
108 Ga0068302_10039006 3300005071 Bacteria 4869

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_117304 Ga0466722_117304_28824_29405 146
2 3300010167 Ga0123353_10025707 Ga0123353_100257072 162
3 3300042599 Ga0466706_096605 Ga0466706_096605_8507_9046 163
4 3300042593 Ga0466691_032873 Ga0466691_032873_2592_3176 165
5 3300002462 JGI24702J35022_10041822 JGI24702J35022_100418222 167
6 3300042596 Ga0466696_051840 Ga0466696_051840_10844_11428 167
7 3300042611 Ga0466697_197696 Ga0466697_197696_12071_12658 169
8 3300042605 Ga0466716_061134 Ga0466716_061134_2142_2726 171
9 3300042615 Ga0466711_405975 Ga0466711_405975_7427_8011 171
10 3300042616 Ga0466715_049725 Ga0466715_049725_1045_1629 171
11 3300042618 Ga0466723_250414 Ga0466723_250414_3175_3759 171
12 3300042652 Ga0466708_058687 Ga0466708_058687_31480_32064 171
13 3300042590 Ga0466690_090860 Ga0466690_090860_8171_8755 172
14 3300042593 Ga0466691_005537 Ga0466691_005537_7733_8317 172
15 3300042618 Ga0466723_046684 Ga0466723_046684_528_1112 172
16 3300005201 Ga0072941_1081145 Ga0072941_10811454 173
17 3300042590 Ga0466690_350935 Ga0466690_350935_20_604 174
18 3300042596 Ga0466696_008129 Ga0466696_008129_6779_7369 174
19 3300042615 Ga0466711_042944 Ga0466711_042944_2747_3331 174
20 3300042615 Ga0466711_253863 Ga0466711_253863_68_652 174
21 3300042648 Ga0466709_127340 Ga0466709_127340_4150_4734 174
22 3300010049 Ga0123356_10895373 Ga0123356_108953732 175
23 3300042590 Ga0466690_247613 Ga0466690_247613_2099_2683 175
24 3300042593 Ga0466691_091910 Ga0466691_091910_1924_2508 175
25 3300042609 Ga0466722_217984 Ga0466722_217984_922_1512 175
26 3300042652 Ga0466708_081429 Ga0466708_081429_8961_9545 175
27 3300042596 Ga0466696_349271 Ga0466696_349271_11247_11831 176
28 3300042602 Ga0466713_155527 Ga0466713_155527_12792_13385 176
29 3300042605 Ga0466716_183262 Ga0466716_183262_5815_6405 176
30 3300042620 Ga0466728_324718 Ga0466728_324718_2697_3281 176
31 3300042620 Ga0466728_332643 Ga0466728_332643_983_1567 176
32 3300042643 Ga0466704_388102 Ga0466704_388102_2712_3302 176
33 2225789004 2227154967 2227562239 177
34 3300005071 Ga0068302_10039006 Ga0068302_100390062 177
35 3300042593 Ga0466691_015647 Ga0466691_015647_1752_2336 177
36 3300042596 Ga0466696_069019 Ga0466696_069019_65_655 177
37 3300042602 Ga0466713_099964 Ga0466713_099964_20128_20724 177
38 3300042612 Ga0466705_409747 Ga0466705_409747_292_882 177
39 3300042612 Ga0466705_449119 Ga0466705_449119_12140_12730 177
40 3300042618 Ga0466723_299222 Ga0466723_299222_13414_14004 177
41 3300042620 Ga0466728_211840 Ga0466728_211840_7660_8250 177
42 3300042624 Ga0466735_159949 Ga0466735_159949_188_784 177
43 3300042643 Ga0466704_266456 Ga0466704_266456_8642_9232 177
44 3300042643 Ga0466704_365178 Ga0466704_365178_23046_23636 177
45 3300042654 Ga0466725_311063 Ga0466725_311063_2447_3037 177
46 3300000062 IMNBL1DRAFT_c0000789 IMNBL1DRAFT_000078910 178
47 3300005083 Ga0068305_10008962 Ga0068305_100089626 178
48 3300042601 Ga0466707_065452 Ga0466707_065452_11755_12354 178
49 3300042602 Ga0466713_015150 Ga0466713_015150_14668_15204 178
50 3300042606 Ga0466719_066426 Ga0466719_066426_1140_1724 178
51 3300042612 Ga0466705_006462 Ga0466705_006462_728_1312 178
52 3300042620 Ga0466728_244432 Ga0466728_244432_18362_18949 178
53 3300042659 Ga0466733_030534 Ga0466733_030534_53173_53757 178
54 3300002462 JGI24702J35022_10000101 JGI24702J35022_1000010122 179
55 3300005083 Ga0068305_10026751 Ga0068305_100267512 179
56 3300042590 Ga0466690_408081 Ga0466690_408081_5966_6553 179
57 3300042596 Ga0466696_260879 Ga0466696_260879_3188_3778 179
58 3300042596 Ga0466696_285470 Ga0466696_285470_1081_1677 179
59 3300042596 Ga0466696_464266 Ga0466696_464266_2441_3031 179
60 3300042601 Ga0466707_089583 Ga0466707_089583_3842_4429 179
61 3300042609 Ga0466722_231624 Ga0466722_231624_1420_2013 179
62 3300042616 Ga0466715_112803 Ga0466715_112803_13442_14032 179
63 3300042619 Ga0466726_232707 Ga0466726_232707_3043_3633 179
64 3300042621 Ga0466729_197205 Ga0466729_197205_3263_3850 179
65 3300042636 Ga0466703_120109 Ga0466703_120109_9860_10447 179
66 3300042652 Ga0466708_149614 Ga0466708_149614_27011_27598 179
67 2225789004 2227313850 2227763060 180
68 3300010167 Ga0123353_10760779 Ga0123353_107607792 180
69 3300042615 Ga0466711_015732 Ga0466711_015732_21556_22146 180
70 3300042615 Ga0466711_472730 Ga0466711_472730_11172_11762 180
71 3300042620 Ga0466728_109044 Ga0466728_109044_576_1166 180
72 3300042624 Ga0466735_124435 Ga0466735_124435_526_1113 180
73 3300042636 Ga0466703_104748 Ga0466703_104748_1016_1600 180
74 3300042643 Ga0466704_147620 Ga0466704_147620_42_632 180
75 3300042643 Ga0466704_147750 Ga0466704_147750_42_632 180
76 2225789004 2227222487 2227655998 181
77 3300000062 IMNBL1DRAFT_c0008392 IMNBL1DRAFT_00083922 181
78 3300042591 Ga0466692_047378 Ga0466692_047378_60255_60845 181
79 3300042591 Ga0466692_109656 Ga0466692_109656_5242_5832 181
80 3300042592 Ga0466693_148862 Ga0466693_148862_461_1051 181
81 3300042593 Ga0466691_005344 Ga0466691_005344_4999_5592 181
82 3300042612 Ga0466705_202820 Ga0466705_202820_362_955 181
83 3300042612 Ga0466705_315203 Ga0466705_315203_3743_4330 181
84 3300042612 Ga0466705_388238 Ga0466705_388238_17689_18273 181
85 3300042615 Ga0466711_299363 Ga0466711_299363_7752_8345 181
86 3300042616 Ga0466715_064135 Ga0466715_064135_2193_2777 181
87 3300042616 Ga0466715_317832 Ga0466715_317832_424_1014 181
88 3300042643 Ga0466704_096470 Ga0466704_096470_1613_2200 181
89 3300042643 Ga0466704_406078 Ga0466704_406078_3003_3590 181
90 3300002462 JGI24702J35022_10003718 JGI24702J35022_100037183 182
91 3300005071 Ga0068302_10042514 Ga0068302_100425143 182
92 3300042593 Ga0466691_226692 Ga0466691_226692_3081_3668 182
93 3300010049 Ga0123356_10986466 Ga0123356_109864662 183
94 3300042619 Ga0466726_231088 Ga0466726_231088_5460_6050 183
95 3300005071 Ga0068302_10247025 Ga0068302_102470252 184
96 3300042624 Ga0466735_005335 Ga0466735_005335_332_922 185
97 3300042624 Ga0466735_223553 Ga0466735_223553_360_950 185
98 3300042616 Ga0466715_521568 Ga0466715_521568_271_855 186
99 3300042652 Ga0466708_264419 Ga0466708_264419_46104_46688 186
100 3300042593 Ga0466691_195041 Ga0466691_195041_363_947 188
101 3300042643 Ga0466704_111547 Ga0466704_111547_1850_2434 188
102 3300042605 Ga0466716_448089 Ga0466716_448089_184_768 189
103 3300042636 Ga0466703_016679 Ga0466703_016679_24091_24708 189
104 iso_pr_bacteria 2820741847 2820744357 193
105 iso_pr_bacteria 2940195863 2940197132 195
106 3300010167 Ga0123353_11087972 Ga0123353_110879722 196
107 3300042615 Ga0466711_037484 Ga0466711_037484_10346_10936 196
108 3300002462 JGI24702J35022_10200198 JGI24702J35022_102001982 197
109 3300010167 Ga0123353_10086853 Ga0123353_100868534 197
110 3300042596 Ga0466696_067990 Ga0466696_067990_2028_2687 202

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01330 RuvA_N RuvA N terminal domain 24 84 0.98
PF07499 RuvA_C RuvA, C-terminal domain 161 202 0.94
PF14520 HHH_5 Helix-hairpin-helix domain 94 127 0.73

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.63 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.